[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACV54634.1 elen0 ACV54634.1 "protein of unknown function DUF917"
MRKIGIQEIEDIALGATLLGAGGGGDPYIGKLTAIGAVKECGEVELIGIDEVPDGAFIMP
AASMGAPTILAEKGVGANEFAKLFDMVSRYYGKPIYATMPIEAGGVNSMLPIAAAARLGI
PMVDVDGMGRAFPELQMVTFTIGGASATPMAFIDEKGNSGILDTITNKWTEDIARAATMT
MGGTLTVALFCMDVDTCKQYGVHGIVTRSEELGRAIRTAKDEAAAAGLTPEEFFLKFTGG
HKLFKGKISDVLRETRGAFNFGRVVLEGIGEDRGSQAFVDFQNENLSCVVDGQIKATVPD
LICLVDPDTFTPVPTDALKYGKRVLAVGLECFHLWRTQAGLDLVGPRYFGIDTDYIPVEE
RSARKEA
//