[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "elen0:ACV54696.1"

            "phosphoribosyl-ATP diphosphatase"
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSQKTYIPSGEMPPSSQIGATFEALAATIAARREAGEESYTYRLLTGSLDGVLKKVMEEA:Sequence : cHHHHHHHHcHHHHHHHHHHHH:Sec Str : XXXXXXXXXXXXXXXXXXXX :SEG|19->38|gatfealaatiaarreagee : ======================:RP:SCP|39->141|1yvwA1|4e-10|34.8|69/92|a.204.1.4 : ======================:BL:SWS|39->163|HIS2_THICR|2e-08|43.7|87/113 61: . . . * . .: 120 :GETALAAKDVESWACSSLAASIAASGAVDETDELAVDLPPEYDAAIDHLRYEAADVVYHL:Sequence :HHHHHHHHHcHccH ccHH HHHHHHHHHHHHHH:Sec Str : XXXXXXXXXXXXXXXX :SEG|72->87|swacsslaasiaasga :============================================================:RP:SCP|39->141|1yvwA1|4e-10|34.8|69/92|a.204.1.4 :============================================================:BL:SWS|39->163|HIS2_THICR|2e-08|43.7|87/113 : $$$$$$$$$$$$$$:RP:PFM|107->141|PF01503|1e-04|51.4|35/85|PRA-PH 121: . . + . . .: 180 :LVVLERYGIGLDEFAAELNNRMTDAERPEGGVRLHEDHVKRGK :Sequence :HHHHHHHTccHHHHHTTcHHcH :Sec Str :===================== :RP:SCP|39->141|1yvwA1|4e-10|34.8|69/92|a.204.1.4 :=========================================== :BL:SWS|39->163|HIS2_THICR|2e-08|43.7|87/113 :$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|107->141|PF01503|1e-04|51.4|35/85|PRA-PH