[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACV54701.1 elen0 ACV54701.1 "hypothetical protein"
MTLFGITVPMEAIWVIVAIIVLVIVGFIAKGFIDEMKK
//