[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "elen0:ACV54852.1"

            "protein of unknown function DUF192"
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNDRYLDEAVAVTASGKRVPILTHTCRGFLERFCGLMLKREVPEACGLYFPGCRSIHTCM:Sequence : ==================================:BL:SWS|27->108|Y1377_METTH|2e-07|40.3|77/123 61: . . . * . .: 120 :MRVPIDVVWVREGEPGELDAVSLDVALKPWRFFAAPRGATGCVEFRAGSFDPADRPAEIA:Sequence :================================================ :BL:SWS|27->108|Y1377_METTH|2e-07|40.3|77/123 121: . . + . . .: 180 :RPKKRK :Sequence