[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACV54852.1 elen0 ACV54852.1 "protein of unknown function DUF192"
MNDRYLDEAVAVTASGKRVPILTHTCRGFLERFCGLMLKREVPEACGLYFPGCRSIHTCM
MRVPIDVVWVREGEPGELDAVSLDVALKPWRFFAAPRGATGCVEFRAGSFDPADRPAEIA
RPKKRK
//