[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "elen0:ACV54955.1"

            "queuine tRNA-ribosyltransferase"
            ""

OrgPattern ----------------11-----1----------1-------------21111---------11--1- 1111-1111111111------1---1------11111111--1---1-----11111111---1-------111111111111111111111-1111--111111111-1111111111111111111111111112222211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1-11-----11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111-1111111111111112221211121-11111111111111111111111111-11111111111111111111111111111111111111--11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112222222222222211111111111111111111111111111111111111111111111111111111111-1-111111--11111111111111111111-1111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111-1-------------------------1111111111111 2211231-612111-221122222222222222111122222211121121111212111121-----------------------12-1112111----1--222123343322212211122221416F2-2251111222222211-2--32112-21112111223322332223X3333132332-22432321 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MALFDCELQATSGHARALSYETAHGSFQTPMFMPVGTSASVKGVTVGQLNDLNAQVVLAN:Sequence : cEEEEEEEETTEEEEEEEETTEEEEEcEEEcEETTcccTTccHHHHHHTTcccEEEc:Sec Str : ==========================================================:RP:SCP|3->370|1iq8A1|5e-94|22.2|324/355|c.1.20.1 : ==============================================:BL:SWS|15->372|TGT_MOOTA|4e-99|51.4|348/373 61: . . . * . .: 120 :TYHLSLRPGADVVAEAGGVHRFMNYDGPMLTDSGGFQVFSLADTLKLDDEGLTFRSIYDG:Sequence :HHHHHHTTcHHHHHHTTcHHHHHTccccEEEcccHHHHHHcccccEEccccEEEEccTcc:Sec Str :============================================================:RP:SCP|3->370|1iq8A1|5e-94|22.2|324/355|c.1.20.1 :============================================================:BL:SWS|15->372|TGT_MOOTA|4e-99|51.4|348/373 121: . . + . . .: 180 :TKVRWTPESNMEIQEQLGADIAMQLDQCTPYPAEKAFVAKAVDLSANWARRCLAAHQRPD:Sequence :cEEEEcHHHHHHHHHHHTccEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHTHH:Sec Str :============================================================:RP:SCP|3->370|1iq8A1|5e-94|22.2|324/355|c.1.20.1 :============================================================:BL:SWS|15->372|TGT_MOOTA|4e-99|51.4|348/373 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|128->373|PF01702|2e-66|51.7|236/238|TGT 181: . * . . . .: 240 :QTLFGIVQGGMELDLRLESIRRLREIEDESLARGGRRFGGFGIGGYSVGEDHEVMFETLG:Sequence :cEEEEEEccTTcHHHHHHHHHHHHHHcccEEEHHHHcccEEEEccccccccHHHHHHHHH:Sec Str : XXXXXXXXXXXXXXXXXXXX :SEG|192->211|eldlrlesirrlreiedesl : XXXXXXXXXXXXX :SEG|213->225|rggrrfggfgigg :============================================================:RP:SCP|3->370|1iq8A1|5e-94|22.2|324/355|c.1.20.1 :============================================================:BL:SWS|15->372|TGT_MOOTA|4e-99|51.4|348/373 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|128->373|PF01702|2e-66|51.7|236/238|TGT 241: + . . . . *: 300 :PVARACPEDRPRYLMGVGNPTTLVRAVREGVDMFDCVLPTRTARMGTAFSSTGRMNMRNA:Sequence :HHGGGccTTccEEETTcccHHHHHHHHHTTccEEEccHHHHHHHHTEEccTTccEETTcG:Sec Str :============================================================:RP:SCP|3->370|1iq8A1|5e-94|22.2|324/355|c.1.20.1 :============================================================:BL:SWS|15->372|TGT_MOOTA|4e-99|51.4|348/373 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|128->373|PF01702|2e-66|51.7|236/238|TGT 301: . . . . + .: 360 :KFTRDFGPLDPACTCPTCRNHSRAYIRHLVKQNEMLGGILLSVHNLHYLIDLMRRAREAV:Sequence :GGTTcccccccccccHHHHHccHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|3->370|1iq8A1|5e-94|22.2|324/355|c.1.20.1 :============================================================:BL:SWS|15->372|TGT_MOOTA|4e-99|51.4|348/373 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|128->373|PF01702|2e-66|51.7|236/238|TGT 361: . . . * . .: 420 :LAGAYEEFYEAWMASPAAKDY :Sequence :HTTcHHHHHHHHHHHHcHTc :Sec Str :========== :RP:SCP|3->370|1iq8A1|5e-94|22.2|324/355|c.1.20.1 :============ :BL:SWS|15->372|TGT_MOOTA|4e-99|51.4|348/373 :$$$$$$$$$$$$$ :RP:PFM|128->373|PF01702|2e-66|51.7|236/238|TGT