[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "elen0:ACV54981.1"

            "two component transcriptional regulator, winged helix family"
            ""

OrgPattern -----------------------1---1-1-1--11--1111161-1H-7323-1--1---------- 9SM7V466778645DCCBB-BN55BDBBBBB9KIKKBGGGCFFIEC778AA9DFG65711MKO7S7KTPQA444476658JB714567JKdW-H22---46J5ACR5UAL--------------152362549293dZZbWH8Fg5zXqjaZEONGH9779B8TVKIv**M684555675545EF977453B7JUUVUVSTWJWSWWURJKGEDGUWcCDEY8GGBAABABje79999998999999989896C675CC655466677CC655675686DED8668A99888888988885555566666655A8767476776TKLfRRRXWVXTTNFdXXADEATMG8BFIOB6fbQID946A676A7327PMHOKKH66666IHTSWGDEIQINPAA9AAAAA99D-NPUMQSPaDPB1SNNPPKQUVPMKINAICECIMHLIEHDDDDDDDDDFCBAAVFE3233333322332333323223223222238EH78DGFCFXWYYdUVLLLHRRYcNLNNEPbVXRURb23OUTfISJKfNQQSAJTPHGDILC2322212CA6JZwDeXKB8UNAXSHGP2iUcZWVXMKTQRUfnCPK7887666666333433333DO6CJAAPKBKQOQ9MKEQGMMJGNIONNKONILMQU--58A89------JKGIGJEKLLMKMMNKL-LNLKLLLKLMLLLLLJLLHOMOGIBAALJLLLLLLJLLKLKLLLIIJIIJLB1FIIIJJIIIJJJ--3F333335655BIpEV433334244443125FFEFH9FABCNLbZdbWgfjPbefZRYUb3212132129HLKPKKKKKLPURTRSLJOJKIJJ9989--g3BB889932222222512-------------------------4A444575555P3 ----21--------4111111111-1111-1-1-1--1111-1--1------------------1--------1-------111--------1-1-111-111232--2-------------------------------------------------4----3-1-------4-235---1---41191-122B---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKKILLIDDENSIARLVGSMAGDAGYAFAYAEDGAEGLVVAEREAPDLVIMDVMMPRMDG:Sequence :cEEEEEEcccHHHHHHHHHHHHTcTTEEEEEccHHHHHHHHHHHcccEEEEccEETTEEH:Sec Str : ==========================================================:RP:SCP|3->119|1p2fA2|5e-29|33.3|114/120|c.23.1.1 : ==========================================================:BL:SWS|3->229|RESD_BACSU|2e-46|41.6|226/240 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->113|PF00072|5e-20|42.7|110/111|Response_reg 61: . . . * . .: 120 :FTTCRLMRERGITCPVIFLSAKGDIVDKGVGFQAGGDDYMVKPFDPRELLMHIEAHLRRA:Sequence :HHHHHHHHHHcTTcEEEEGGGcccHHHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHG:Sec Str :=========================================================== :RP:SCP|3->119|1p2fA2|5e-29|33.3|114/120|c.23.1.1 :============================================================:BL:SWS|3->229|RESD_BACSU|2e-46|41.6|226/240 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|4->113|PF00072|5e-20|42.7|110/111|Response_reg 121: . . + . . .: 180 :SMAAAPVAPRGDILHAGRFVLDRGQFRVTKDGERLSLTPKEFKIFFALASSPGLVLSKEQ:Sequence :GGccHHHHGGGTTGHHHHHHHHHHHHHHHHccTTTTccHHHHHHHHHHTTTccHHHHHTT:Sec Str : ==========================================================:RP:SCP|123->231|1ys6A1|1e-26|32.1|106/106|a.4.6.1 :============================================================:BL:SWS|3->229|RESD_BACSU|2e-46|41.6|226/240 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|152->227|PF00486|4e-15|42.1|76/77|Trans_reg_C 181: . * . . . .: 240 :LVEAAWGKEFVGETSSITVFIKKLREKVEDDPSDPRVIQTVWGIGYRFEPEGREG :Sequence :ccHHHHHHHHTccHHHHHHHHHHHHHHTTccHcccHHHHHHHHHTccTTTTHHH :Sec Str :=================================================== :RP:SCP|123->231|1ys6A1|1e-26|32.1|106/106|a.4.6.1 :================================================= :BL:SWS|3->229|RESD_BACSU|2e-46|41.6|226/240 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|152->227|PF00486|4e-15|42.1|76/77|Trans_reg_C