[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "elen0:ACV55062.1"

            "oxidoreductase molybdopterin binding"
            ""

OrgPattern ------1-------11-1-------------------------------------------------- --------------------------------1-----------1-----------------------------------B7---------------------------------------------------------------11--------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--11-------------------1---2------------1----1-3------------------------------------------------------------------------------------------------1-1-----------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MAYNPKKIAGGVAGGALLMFGAVGGIGATAGLPQTADADPIATTHAVGDNVVTAQWFNED:Sequence : :Sec Str 61: . . . * . .: 120 :DVSYVSVANAQGAFTFNQEGVTPNDELFNVFGTALTSMCSKPATELVDVEGGVANFYVNV:Sequence : GGGGGccccccGGGGcccccccccccccTTTcccccccccTTTcEEEE:Sec Str : ==============================================:RP:SCP|75->249|1xdqA|6e-11|21.1|166/262|d.176.1.1 : ======:BL:SWS|115->249|NIA_BEABA|4e-07|29.6|135/894 : $$$:RP:PFM|118->248|PF00174|5e-12|29.8|131/156|Oxidored_molyb 121: . . + . . .: 180 :GGNIKKNFTIDVRDLAEDANQETMMACSCATGSPFGQAAVMGVPLSAVVEMADLEDGVNT:Sequence :EcTTccEEEEEHHHHHHcccEEEEEEEEcTTcccccTTcEEEEEHHHHHHHTTccccccE:Sec Str :============================================================:RP:SCP|75->249|1xdqA|6e-11|21.1|166/262|d.176.1.1 :============================================================:BL:SWS|115->249|NIA_BEABA|4e-07|29.6|135/894 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|118->248|PF00174|5e-12|29.8|131/156|Oxidored_molyb 181: . * . . . .: 240 :ITAYGADGFGQPLPLRYALEKNALLAYQVNGQELEAATGSSLQLWMPETVARYFTRDIVN:Sequence :EEEEEEEEEEEEEEHHHHHTTccEEEEEETTEEccGGGTTTcEEEcTTccGGGccccEEE:Sec Str :============================================================:RP:SCP|75->249|1xdqA|6e-11|21.1|166/262|d.176.1.1 :============================================================:BL:SWS|115->249|NIA_BEABA|4e-07|29.6|135/894 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|118->248|PF00174|5e-12|29.8|131/156|Oxidored_molyb 241: + . . . . *: 300 :IELTQEDAEPDVQQVDPCYRNKINIMNYSDDCVFKAGDEITFEGVADDLGSPIAAIEFSF:Sequence :EEEEccccccHHHHccccccccEEEEEEccTTcEEccEEEEEEEEEccTTccEEEEEEEc:Sec Str :========= :RP:SCP|75->249|1xdqA|6e-11|21.1|166/262|d.176.1.1 : ====================================:RP:SCP|265->358|1ogpA1|3e-08|20.4|93/127|b.1.18.6 :========= :BL:SWS|115->249|NIA_BEABA|4e-07|29.6|135/894 :$$$$$$$$ :RP:PFM|118->248|PF00174|5e-12|29.8|131/156|Oxidored_molyb : $$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|277->349|PF03404|2e-04|30.1|73/120|Mo-co_dimer 301: . . . . + .: 360 :DNGRTWTSCDTDGATADKWVNWQFTTSFEEKGDYRMTVRAKTADGMVSPLAATLLFEVA :Sequence :ccccccEEcEEEcTcccccEEEEEEEEEcTTcEEEEEEEEEETTccccccccGGGccTT :Sec Str :========================================================== :RP:SCP|265->358|1ogpA1|3e-08|20.4|93/127|b.1.18.6 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|277->349|PF03404|2e-04|30.1|73/120|Mo-co_dimer