[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "elen0:ACV55075.1"

            "translation elongation factor Ts"
            ""

OrgPattern -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111-11-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 ----111-211----------------------------------------------------------------------------------1---------1-1--41212111-111-1112--21491-211-1-11-11--111-1-11----2---11--111----1-2112S111215232-241211-12 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MAAVTASMVKELREMTGAGMMECKKALVEADGNIDQAVDVLRTRGLAAVAKKAGRATNEG:Sequence :HcccccTTTTTHHHHHcccHHHHHHHHHHTTTcTTTTHHHHHHHHHHHHHHHTTcccccc:Sec Str : ################ :PROS|12->27|PS01126|EF_TS_1|PDOC00867| : ====================================================== :RP:SCP|2->55|1xb2B1|2e-18|31.5|54/56|a.5.2.2 : =======:RP:SCP|54->150|1xb2B2|5e-17|31.6|95/111|d.43.1.1 : =========================================================:BL:SWS|4->286|EFTS_CLOBB|2e-59|43.6|280/303 61: . . . * . .: 120 :TVMAIVSDDATSGAVVELNCETDFVGMNDKFKAYAEKIAQAALASKPADLEALKAADAAG:Sequence :EEEEEEcTTccEEEEEEEEcccHHHHTcHHHHHHHHHHHHHHHHHccTccHHHHHHHHHH:Sec Str : XXXXXXXXXXXX :SEG|108->119|adlealkaadaa :============================================================:RP:SCP|54->150|1xb2B2|5e-17|31.6|95/111|d.43.1.1 :============================================================:BL:SWS|4->286|EFTS_CLOBB|2e-59|43.6|280/303 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|74->285|PF00889|3e-30|46.2|199/215|EF_TS 121: . . + . . .: 180 :ETVEAVVTDAIHTLGENIQLARFAVVEGGAVSSYIHGGGKIGVLVQFDVEGIDPASDGFK:Sequence :HHHTTcccccccTTHHHHcTTTHHHHHHHHccccTTEcTTccHHHHEEEEcccHHcHHHH:Sec Str :============================== :RP:SCP|54->150|1xb2B2|5e-17|31.6|95/111|d.43.1.1 : ===================================:RP:SCP|146->285|1aipC2|8e-31|32.9|140/143|d.43.1.1 :============================================================:BL:SWS|4->286|EFTS_CLOBB|2e-59|43.6|280/303 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|74->285|PF00889|3e-30|46.2|199/215|EF_TS 181: . * . . . .: 240 :QFGRDVAMQVAAAAPVAATRESVDPAIVEHEKAIYMAQAAESGKPEAIQEKMATGRLEKF:Sequence :HHHHHHHHHHHHHccccccGGGccHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHH:Sec Str : XXXXXXXXXXXXX :SEG|186->198|vamqvaaaapvaa :============================================================:RP:SCP|146->285|1aipC2|8e-31|32.9|140/143|d.43.1.1 :============================================================:BL:SWS|4->286|EFTS_CLOBB|2e-59|43.6|280/303 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|74->285|PF00889|3e-30|46.2|199/215|EF_TS 241: + . . . . *: 300 :FKESTLTEQPFVKNPDQSVSEYAAEVAKNLGGEIKIVDFKRFVLGE :Sequence :HHHHcTTTcEETTEEEEEHHHHHHTTHHHHcTTcEEEEEEEEETTT :Sec Str :============================================= :RP:SCP|146->285|1aipC2|8e-31|32.9|140/143|d.43.1.1 :============================================== :BL:SWS|4->286|EFTS_CLOBB|2e-59|43.6|280/303 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|74->285|PF00889|3e-30|46.2|199/215|EF_TS