[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "elen0:ACV55138.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ---------------------------------------------------------------------------1---11----------------------------------------------------------------------------------------------------------------111111-----1--------------------------------------------------------------------------------------------------------------------------------------1------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MMEARTRPFFSVFRAEVLKGRRGAPRKVALIAPLPFCALGVLSSGVIPGTGATGGVATYL:Sequence 61: . . . * . .: 120 :WNFWYVLMMPVAIALICVSVANIDARQKLRSVLALPFPPARTWWAKVCYALALAFAANLA:Sequence : XXXXXXXXXXXXXXXX:SEG|105->123|akvcyalalafaanlavlv 121: . . + . . .: 180 :VLVCSTALGAMGVDAPGFAEGLAAATILTVASSWMVPAALALTVRFGTLAGIAIPVLLQL:Sequence :XXX :SEG|105->123|akvcyalalafaanlavlv 181: . * . . . .: 240 :GAGIALYSSAAWFAFPPATTLCAVSPLLGVAPSGVPLEAGEALGAFGWEAVVGIVVAAVL:Sequence : XXXXXXXXXXX:SEG|230->249|avvgivvaavlfavlawaga 241: + . . . . *: 300 :FAVLAWAGATWFSKREAA :Sequence :XXXXXXXXX :SEG|230->249|avvgivvaavlfavlawaga