[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACV55138.1 elen0 ACV55138.1 "hypothetical protein"
MMEARTRPFFSVFRAEVLKGRRGAPRKVALIAPLPFCALGVLSSGVIPGTGATGGVATYL
WNFWYVLMMPVAIALICVSVANIDARQKLRSVLALPFPPARTWWAKVCYALALAFAANLA
VLVCSTALGAMGVDAPGFAEGLAAATILTVASSWMVPAALALTVRFGTLAGIAIPVLLQL
GAGIALYSSAAWFAFPPATTLCAVSPLLGVAPSGVPLEAGEALGAFGWEAVVGIVVAAVL
FAVLAWAGATWFSKREAA
//