[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "elen0:ACV55195.1"

            "pyridoxal-phosphate dependent TrpB-like enzyme"
            ""

OrgPattern 22111-112222222212212122111212122121111111122122222221221121-2111-11 112-112211111111111-121112111111222212121211-111-11-121111--222-111111111111-1--112212112222-2---111-111111111-1--111-11-----22222222222222222221211211111111111111111112211111111111111111122111111111111-111111111111111221111111111112-1111111111111111111----11-----11--11----1-111-------11111111111111-------------1--111----21-11-------1-12-221---2-2--11122221221112111121-11211111-----111111113222211111111111-11111111111-1111111111111111111122221111111111111111212------------------------------11111111111111111111111111111-1111111111111111222112121122111121111111111212-21122212212211212222422222211222111111111111111111122212111111212111--------1---------11---122211---1-111111------------------------------1--1111111111111111111111-------1--11111121111-1-1111-1111111212111-11-----1--122222211221111111111111112111111111111211111111111---111111111111111121111111----------1-------------------------1112121232122 --11--1-----11111111132344311111111111111111-111112212-1111211111111-1111211111111111111-11111111111-21112-111-----------------------------------------------------2---------2-1111D1112141561322121111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTEQAPHRLYLREDQIPTQWYNLRADMPEKPEPIRLPNGQVAAPEDLAPVFCDELVRQEL:Sequence : ccccccTTcccccccccEEEEETEEEEEccGGGHHHHHHHHHHHHH:Sec Str : ========================:RP:SCP|37->432|1a50B|1e-42|25.2|369/390|c.79.1.1 : =====================================================:BL:SWS|8->437|TRPB2_METMA|e-120|54.5|426/442 61: . . . * . .: 120 :DDDTAYVDIPEPVLEMYRIYRPSPLCRAYNLEKALGTPAKIYYKFEGNNTSGSHKLNSAI:Sequence :HTcHHHHHHHHHHHHHTTTcccccEEEcccTTTTccccEEEEEEEGGGcTTccTHHHHHH:Sec Str :============================================================:RP:SCP|37->432|1a50B|1e-42|25.2|369/390|c.79.1.1 :============================================================:BL:SWS|8->437|TRPB2_METMA|e-120|54.5|426/442 121: . . + . . .: 180 :AQAYYAKAQDLDGITTETGAGQWGTALAEASAHFGLNLDVFMVKCSYEQKPFRRNIMETF:Sequence :HHHHHHHHTTccEEEEEEcccHHHHHHHHHHHHHTcEEEEEEEHHHHHHcHHHHHHHHHT:Sec Str :============================================================:RP:SCP|37->432|1a50B|1e-42|25.2|369/390|c.79.1.1 :============================================================:BL:SWS|8->437|TRPB2_METMA|e-120|54.5|426/442 181: . * . . . .: 240 :DAHVTPSPSDTTEIGRKMLAEHPDSSGSLGTAISEAVERALNIPGNKGRYTLGSVLNQVV:Sequence :TcEEEEEccTGHHHHHHHHHHEccTTccHHHHHHHHHHHHHHHTTTTEEEcccccccHHH:Sec Str :============================================================:RP:SCP|37->432|1a50B|1e-42|25.2|369/390|c.79.1.1 :============================================================:BL:SWS|8->437|TRPB2_METMA|e-120|54.5|426/442 241: + . . . . *: 300 :LHQSVIGLESYAAFEELGEYPDVVIGCAGGGSNLGGLIAPFMRDKIKGVRPDTRFVAVEP:Sequence :HTTTHHHHHHHHHHHHHcccccEEEEEccccHHHHHHHGGGTTcHTTcTcTTcEEEEEEE:Sec Str : XXXXXXXXXXX :SEG|266->276|gcagggsnlgg :============================================================:RP:SCP|37->432|1a50B|1e-42|25.2|369/390|c.79.1.1 :============================================================:BL:SWS|8->437|TRPB2_METMA|e-120|54.5|426/442 301: . . . . + .: 360 :ASCPSLTRGRYAYDFADTGRTCPLAKMYTLGNGFLPSPDHAGGLRYHGMSPIVSKLKHDG:Sequence :EETcGGGTccccHHHHcEEEEETEEEEEEcTccccccccccGGGccccccHHHHHHHHTT:Sec Str :============================================================:RP:SCP|37->432|1a50B|1e-42|25.2|369/390|c.79.1.1 :============================================================:BL:SWS|8->437|TRPB2_METMA|e-120|54.5|426/442 361: . . . * . .: 420 :YLDAVAVKQTDVFAAAVEFARLETILPAPESAHAIFQAVEEAKRCAETGEEKTILFGLTG:Sequence :ccEEEEEEHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcTcTTccEEEEEEEcc:Sec Str :============================================================:RP:SCP|37->432|1a50B|1e-42|25.2|369/390|c.79.1.1 :============================================================:BL:SWS|8->437|TRPB2_METMA|e-120|54.5|426/442 421: . . + . . .: 480 :TGYFDMKAYDAYNRGEMSDHVPTDEELEAGFASIPHIEGVQ :Sequence :ccGGGHHHHHHHHHcTcTTcccTTccccHcHHHHHHHHH :Sec Str :============ :RP:SCP|37->432|1a50B|1e-42|25.2|369/390|c.79.1.1 :================= :BL:SWS|8->437|TRPB2_METMA|e-120|54.5|426/442