[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACV55195.1 elen0 ACV55195.1 "pyridoxal-phosphate dependent TrpB-like enzyme"
MTEQAPHRLYLREDQIPTQWYNLRADMPEKPEPIRLPNGQVAAPEDLAPVFCDELVRQEL
DDDTAYVDIPEPVLEMYRIYRPSPLCRAYNLEKALGTPAKIYYKFEGNNTSGSHKLNSAI
AQAYYAKAQDLDGITTETGAGQWGTALAEASAHFGLNLDVFMVKCSYEQKPFRRNIMETF
DAHVTPSPSDTTEIGRKMLAEHPDSSGSLGTAISEAVERALNIPGNKGRYTLGSVLNQVV
LHQSVIGLESYAAFEELGEYPDVVIGCAGGGSNLGGLIAPFMRDKIKGVRPDTRFVAVEP
ASCPSLTRGRYAYDFADTGRTCPLAKMYTLGNGFLPSPDHAGGLRYHGMSPIVSKLKHDG
YLDAVAVKQTDVFAAAVEFARLETILPAPESAHAIFQAVEEAKRCAETGEEKTILFGLTG
TGYFDMKAYDAYNRGEMSDHVPTDEELEAGFASIPHIEGVQ
//