[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "elen0:ACV55248.1"

            "NADPH-dependent FMN reductase"
            ""

OrgPattern -------1-----------------------------------11----------------1------ --11211------11--11-11--1211111111111-11----1---122-221-------1-11111---222---3-1------------------1-1--111--2--------------211--1---1----------11211111---11----------111---------------1-------1-----------------11----1---11-1------11--------------------32-2222-2-28833--12341111122231113663333333333311111111111113-12211115--1-2------------------1-11-1----11---------------1--1111-------12222122111----------1-----1---13--2---222222111111--121-1111-111111111------1--------------------------------1--111112222221111111111111-1221112---111--12231322211111--1-1111111--1-111-------1----1-1-1-------1112----------------------------11---1----11---------------------------------11-1-111111111111-1111111111111111111111----11111111111111111111-111---1--------------------1111--2--111---------------------1-11111111111111-111------------------------2111111111--------11--1------------------------------1-----------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------233-11--2---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKLLAIAGSLRENSYNRQLAEAAGALMREKHPEVGYGILRWEDVPFMNQDIEHPAPEAVM:Sequence :cEEEEEEccccGGcHHHHHHHHHHHHHHHHcTEEEEEETTTTTcccccTTGHHHHHHHHH:Sec Str : =========================================================:RP:SCP|4->183|1nni1|9e-28|27.3|161/171|c.23.5.4 :============================================================:BL:SWS|1->184|YIEF_SHIFL|1e-23|39.3|173/188 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|2->137|PF03358|4e-13|37.6|133/149|FMN_red 61: . . . * . .: 120 :RVREAVREADGLWLFSPEYNHAIPGPLKNLLDWLSRPVSATEAQVLAEKPVALAGASIGM:Sequence :HHHHHHHHccEEEEEccEETTEEcHHHHHHHHHHcccTTTEEcEcccccEEEEEEEcccc:Sec Str :============================================================:RP:SCP|4->183|1nni1|9e-28|27.3|161/171|c.23.5.4 :============================================================:BL:SWS|1->184|YIEF_SHIFL|1e-23|39.3|173/188 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|2->137|PF03358|4e-13|37.6|133/149|FMN_red 121: . . + . . .: 180 :SGASHAQDQLVGMLSFLDAHVMNKPRLCIPHIATQADEQGRLKLESSAPYLEAQADAFVR:Sequence :cTTccHHHHHHHHHHHTTcccEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|4->183|1nni1|9e-28|27.3|161/171|c.23.5.4 :============================================================:BL:SWS|1->184|YIEF_SHIFL|1e-23|39.3|173/188 :$$$$$$$$$$$$$$$$$ :RP:PFM|2->137|PF03358|4e-13|37.6|133/149|FMN_red 181: . * . . . .: 240 :FVEREQG :Sequence :HHHH :Sec Str :=== :RP:SCP|4->183|1nni1|9e-28|27.3|161/171|c.23.5.4 :==== :BL:SWS|1->184|YIEF_SHIFL|1e-23|39.3|173/188