[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "elen0:ACV55249.1"

            "hydrogenase maturation protease"
            ""

OrgPattern -------------------------------------------------------------------- -------------------------------------------------------------------------------111-1-1-------------------------------------------------------111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------1------------------------1------------------------------------------------------------------------1----------------------------------------------------------------------------------------1------------------1-1--1111-11222-1---11----------1---------------------------------------1111-1-1111-1-111--------------1------1111111111-11111-1111111111111--------11111111111-1-11-1111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MGAARRIAVFCVGNKLMLDDGVGPAVYEELLTRYDIPDNVELFDLGCLSLNMIERVREYD:Sequence : cccccEEEEEEccTTcGGGGHHHHHHHHHHHHEEccTTEEEEEEETccGGGHHHHcccc:Sec Str : =======================================================:RP:SCP|6->166|1cfzA|2e-25|28.5|158/162|c.56.1.1 : ======================================================:BL:SWS|7->97|HUPD_THIRO|5e-11|40.0|90/221 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|26->151|PF01750|2e-07|34.1|123/128|HycI 61: . . . * . .: 120 :VIITVDAVDGTDADPGTVFRFEPDAMARHSGATASLHDLKLVDLFDAAALLGYEAEGLCL:Sequence :EEEEEEEcccccccTTcEEEEETTHHHHHHcccccHHHHHHHHHHHHHHTTccccEEEEE:Sec Str : XXXXXXXXXXXXXX:SEG|107->121|aaallgyeaeglclg :============================================================:RP:SCP|6->166|1cfzA|2e-25|28.5|158/162|c.56.1.1 :===================================== :BL:SWS|7->97|HUPD_THIRO|5e-11|40.0|90/221 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|26->151|PF01750|2e-07|34.1|123/128|HycI 121: . . + . . .: 180 :GMQVENPSPAVVTVGLTPKVDAALPLLVETVAGELARLGSPLRARA :Sequence :EEccccccccccTccccHHHHTTHHHHHHHHHHHHHTTTcccEEGG :Sec Str :X :SEG|107->121|aaallgyeaeglclg :============================================== :RP:SCP|6->166|1cfzA|2e-25|28.5|158/162|c.56.1.1 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|26->151|PF01750|2e-07|34.1|123/128|HycI