[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "elen0:ACV55343.1"

            "transcriptional regulator, XRE family"
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------3------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKSDGRRIILGKTIKMLREEQHLSQRRFALMVGTNQTHLWQIECGQVSVGIDLLCRIADG:Sequence :ccHHHHHHHHHHHHHHHHHHTTccHHHHHHHHTccHHHHHHHHHcGGGccHHHHHHHHHH:Sec Str : ======================================================:RP:SCP|7->70|2o38A1|7e-10|20.3|64/89|a.35.1.13 : ======================================================:BL:SWS|7->71|CEBA_BACAM|5e-06|29.2|65/102 61: . . . * . .: 120 :LDIKVKDLIDF :Sequence :TTcccccccHc :Sec Str :========== :RP:SCP|7->70|2o38A1|7e-10|20.3|64/89|a.35.1.13 :=========== :BL:SWS|7->71|CEBA_BACAM|5e-06|29.2|65/102