[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "elen0:ACV55382.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSKKKMRAFAGAMAVVLAFVPFLSGCAANDAEDNPQAQQELNADEQSRNEAEGSIGETVQ:Sequence : ==================================================:BL:SWS|11->151|FLGH_CUPTR|4e-04|27.0|141/229 61: . . . * . .: 120 :YGQVMAMNGSTATVVVGTLANANDGSGSQAFNAGQDEITFDEGDVSIVDESGAELEGRTL:Sequence :============================================================:BL:SWS|11->151|FLGH_CUPTR|4e-04|27.0|141/229 121: . . + . . .: 180 :SADDVIVMRGTGSGTDFKPTTIEILDVAGAGTNADDARVPQGVK :Sequence :=============================== :BL:SWS|11->151|FLGH_CUPTR|4e-04|27.0|141/229