[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "elen0:ACV55454.1"

            "ABC transporter related"
            ""

OrgPattern LKA9HHEDNNNJOJPEdDMLGKNUqMRaeRYPC6DDD9FFFBBPXORfGO*pY8KTKQTKNDF9S167 OTdI*aZepppUUTXUSLL-Ld88W*LLLLMLkgghs***P*V*w*wisbYN***QRhBBox*g*lx***hZYXXuZYgQ*hgB89ADQQMI3ICHI--DEPGGHVIYNQ68888788689999ESOJTaOJRRWPaiityGGIzRkWemZYcWdTVREMJNKUdYl***TGPHHGGFPFJHEgdbMKld9Yar********u********zzww***ais*zlkvuutvu**WZaaZaXUYYZZZYWSURSWzlVc**dPeYjwtMN**eSQVhidfilkpyvpyrvxpsqmnlrtmqoZbbabaddeddacuqpkjgrqskk*w*********Z*gmzwwYccZ*efnv*hfPI**jdVVaXOWialiPSYTLXRRRKKMLLNcR***XUr****************-nu*mi*p***SA**************JIN**********TSTTTTTTyWbKRlV*776666667679678A79976A87A86A5GDDLCD***********vqqsm*****w*yc********AKvupycojl*w****VgcHTHNiQGJHGIFHNNPWncXu*QfRrkUjtVUiEXVYQQWcMWTVSUpxVzHJJOCEEEEFE75A9AA99AFQCDEIHpotNlNTFRKnPTXYSOTbQRRTSVXaUYV5-FJUQM322222*u**X*vy***z*z*ww-*xxx*uywz****uvxuuw*****koiqrkopqqqpqonqnoo*plmrrqtS4************34HDDGDDEOORPJC*h*VTTWXXHNPMKQPRYOQSRQHNHKTkaororx***q**uuc***BCCACCDBCKbmkykmlmkuzwxxNPPJNKKOPRDDDD55MRNNEECD66564767*BVC9A8C-77A6CB8HIE98D89A999RZiONZvdiZAXO 7866dYM-jMABWeYKNSKMRUTfUjPLLEGGHTUOGONMNIIDEEWQSdaahcOLVLOLLMHEB7AA2EA5DBFCD2DF9998FD69-ZmFNQTQGGHMECIUTJ7L*o*dkWzfxPLNMMVOjqM*I**o2xV*OOONkMQ*eHRNKHgLF*PbXUsOg*OtTYT*bh*sm*cGKKF*EHCJMtmm*Jy*LM*qy*j ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSKESKGRKPGALSRCLRFAGRRKPLVFASMALAVLSAAASFVPYVAIYFMIRDAVGVYP:Sequence : XXXXXXXXXXXXXXXXXX :SEG|26->43|lvfasmalavlsaaasfv : ===============:RP:SCP|46->278|2hydA2|2e-11|13.4|231/323|f.37.1.1 61: . . . * . .: 120 :NLAAVDVSAMTGYAGLAVAGIVVDVGCYLAALLCSHAAAFDAQYRTKLDIAAHLGRIPLG:Sequence :============================================================:RP:SCP|46->278|2hydA2|2e-11|13.4|231/323|f.37.1.1 : $$$$$:RP:PFM|116->250|PF00664|3e-08|22.2|133/274|ABC_membrane 121: . . + . . .: 180 :HIARLGTGRISKVMDESVGGIEQFIGHSIPDLAATAAAPVVLAALLFVFDWRFGVATLAA:Sequence : XXXXXXXXXXXXXXX :SEG|152->166|laataaapvvlaall : XXXXXX:SEG|175->187|vatlaavavacvv :============================================================:RP:SCP|46->278|2hydA2|2e-11|13.4|231/323|f.37.1.1 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|116->250|PF00664|3e-08|22.2|133/274|ABC_membrane 181: . * . . . .: 240 :VAVACVVQFSGYADKRVMASMGRYQEVKEQMGNASVEYVRGMRVVKAFGQTARSFKRLSD:Sequence :XXXXXXX :SEG|175->187|vatlaavavacvv :============================================================:RP:SCP|46->278|2hydA2|2e-11|13.4|231/323|f.37.1.1 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|116->250|PF00664|3e-08|22.2|133/274|ABC_membrane 241: + . . . . *: 300 :AIKDYTGLSLDVTLFFRNSMPGFTAVLNNAYLFVLPVGILLAPGAQDWPTFVLSLVFYLL:Sequence : XXXXXXXXXX:SEG|291->302|fvlslvfyllfv :====================================== :RP:SCP|46->278|2hydA2|2e-11|13.4|231/323|f.37.1.1 :$$$$$$$$$$ :RP:PFM|116->250|PF00664|3e-08|22.2|133/274|ABC_membrane 301: . . . . + .: 360 :FVHSISSVFTKILYVSEDGMLAQANIDRIDSVLGIEELSCPEAPKAPKDASVSLRDVTFS:Sequence :XX :SEG|291->302|fvlslvfyllfv : ==============================:RP:SCP|331->585|1q3hA|1e-37|18.0|238/265|c.37.1.12 : ============:BL:SWS|349->1208|AB2B_ARATH|e-105|32.4|836/1233 361: . . . * . .: 420 :YEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREM:Sequence :============================================================:RP:SCP|331->585|1q3hA|1e-37|18.0|238/265|c.37.1.12 :============================================================:BL:SWS|349->1208|AB2B_ARATH|e-105|32.4|836/1233 421: . . + . . .: 480 :GQDELMGSLSLVFQDSHLFRESVAENIRRGRPGATDDEVVEAAKAAQADAFINGLPHGYA:Sequence : XXXXXXXXXXXXXXXXX :SEG|454->470|atddevveaakaaqada :============================================================:RP:SCP|331->585|1q3hA|1e-37|18.0|238/265|c.37.1.12 :============================================================:BL:SWS|349->1208|AB2B_ARATH|e-105|32.4|836/1233 481: . * . . . .: 540 :TVIGSEGVHLSGGEQQRIAIARSIISDAPIVVLDEATAFSDPENEHLIQKAFERLMAGKT:Sequence : XXXXXXXXXXXX :SEG|495->506|qqriaiarsiis : ############### :PROS|490->504|PS00211|ABC_TRANSPORTER_1|PDOC00185| :============================================================:RP:SCP|331->585|1q3hA|1e-37|18.0|238/265|c.37.1.12 :============================================================:BL:SWS|349->1208|AB2B_ARATH|e-105|32.4|836/1233 541: + . . . . *: 600 :VIMVAHRLSTVVGADKIVVLDGGRKVEEGTHQELLAASGTYAKMWRQYTEAVEWGIEAAP:Sequence :============================================= :RP:SCP|331->585|1q3hA|1e-37|18.0|238/265|c.37.1.12 :============================================================:BL:SWS|349->1208|AB2B_ARATH|e-105|32.4|836/1233 601: . . . . + .: 660 :RDDTRSSEATAPHATQGVSAEEYDPAEKPGKPSSGRAPWLQRTFNLSDEGYVGLKRSAIA:Sequence : ===:RP:SCP|658->957|2hydA2|3e-31|16.8|297/323|f.37.1.1 :============================================================:BL:SWS|349->1208|AB2B_ARATH|e-105|32.4|836/1233 661: . . . * . .: 720 :CTLSDLALMIPFVCTVAAFAALVGTLAGEPFDAAALWSIFAVGLAGMVVVFVASRNDYKK:Sequence :============================================================:RP:SCP|658->957|2hydA2|3e-31|16.8|297/323|f.37.1.1 :============================================================:BL:SWS|349->1208|AB2B_ARATH|e-105|32.4|836/1233 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|666->920|PF00664|6e-18|26.1|245/274|ABC_membrane 721: . . + . . .: 780 :TYVAAYTESEGTRLRLADHLRKLPMSFFNRRDTTDVADRIMGDVTAQESMLSSTLPQLIA:Sequence :============================================================:RP:SCP|658->957|2hydA2|3e-31|16.8|297/323|f.37.1.1 :============================================================:BL:SWS|349->1208|AB2B_ARATH|e-105|32.4|836/1233 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|666->920|PF00664|6e-18|26.1|245/274|ABC_membrane 781: . * . . . .: 840 :GIVSTVVICAMLAFFDWRLACCVMVTLPLSAGVIALSRRHQSRLFERQNRVRLDALACVQ:Sequence :============================================================:RP:SCP|658->957|2hydA2|3e-31|16.8|297/323|f.37.1.1 :============================================================:BL:SWS|349->1208|AB2B_ARATH|e-105|32.4|836/1233 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|666->920|PF00664|6e-18|26.1|245/274|ABC_membrane 841: + . . . . *: 900 :DYLEGIKDMRACRAVGKDSAAMEQAMLELKRVTMRVELAVDVSVSLASAILRSGVGLTAC:Sequence :============================================================:RP:SCP|658->957|2hydA2|3e-31|16.8|297/323|f.37.1.1 :============================================================:BL:SWS|349->1208|AB2B_ARATH|e-105|32.4|836/1233 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|666->920|PF00664|6e-18|26.1|245/274|ABC_membrane 901: . . . . + .: 960 :VGAVLLASGGVDFMVLLMFLLIVSRVYGPILALVSQLPNLLNLSTKTARIKAVMDEPEAR:Sequence :========================================================= :RP:SCP|658->957|2hydA2|3e-31|16.8|297/323|f.37.1.1 :============================================================:BL:SWS|349->1208|AB2B_ARATH|e-105|32.4|836/1233 :$$$$$$$$$$$$$$$$$$$$ :RP:PFM|666->920|PF00664|6e-18|26.1|245/274|ABC_membrane 961: . . . * . .:1020 :GSASADVPGHDLSFQGVRFGYGDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKF:Sequence : =================================================:RP:SCP|972->1195|1b0uA|5e-45|29.4|221/258|c.37.1.12 :============================================================:BL:SWS|349->1208|AB2B_ARATH|e-105|32.4|836/1233 : $$$$$$$$$$:RP:PFM|1011->1136|PF00005|3e-12|42.9|112/123|ABC_tran 1021: . . + . . .:1080 :WEPDSGRVLCSGKDIAEFSEESWLAHVSIVFQDVVLFDDTVANNIRIGREGASDEEVAEA:Sequence :============================================================:RP:SCP|972->1195|1b0uA|5e-45|29.4|221/258|c.37.1.12 :============================================================:BL:SWS|349->1208|AB2B_ARATH|e-105|32.4|836/1233 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1011->1136|PF00005|3e-12|42.9|112/123|ABC_tran 1081: . * . . . .:1140 :ARAAHCLEFIERLPQGFDTVLGENGASLSGGERQRLSIARALLKDAPVVLLDEATASLDP:Sequence : ############### :PROS|1108->1122|PS00211|ABC_TRANSPORTER_1|PDOC00185| :============================================================:RP:SCP|972->1195|1b0uA|5e-45|29.4|221/258|c.37.1.12 :============================================================:BL:SWS|349->1208|AB2B_ARATH|e-105|32.4|836/1233 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|1011->1136|PF00005|3e-12|42.9|112/123|ABC_tran : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1108->1175|PF02463|7e-05|36.8|68/536|SMC_N 1141: + . . . . *:1200 :ENETLIQRAVGTLCAGKTVIVIAHRLRTVANADKIVVLDSGRVAEEGNHKTLLAEDGLYA:Sequence :======================================================= :RP:SCP|972->1195|1b0uA|5e-45|29.4|221/258|c.37.1.12 :============================================================:BL:SWS|349->1208|AB2B_ARATH|e-105|32.4|836/1233 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|1108->1175|PF02463|7e-05|36.8|68/536|SMC_N 1201: . . . . + .:1260 :RLWRLQQESSSWTVPADRGDAADVPTGR :Sequence :======== :BL:SWS|349->1208|AB2B_ARATH|e-105|32.4|836/1233