[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "elen0:ACV55525.1"

            "isoleucyl-tRNA synthetase"
            ""

OrgPattern 33223243233333333333333243343433323332333333333333333333333333333233 3333222222222222222-22222222222222222222322233222333333333333333222222322222223333433333222222332122222222223222222222222222333233333333222333333333333333333333333333333333333333333333334433333344444444444444433333344433334333333334333333333343333323333332222233332233223322223333333333333333333333333333323333333333333333333333333333333333333333233333323333333343343333333242333343333333333333333333333333333133333333333243333334433333333333333333333333333323324332223222233333223333332332333332333333333222222334432222444422222222233223222333333332233333233333333333333233333333333333333333333333353333333333333333333333333333333333333333233333333333333333333-2333333333334333333333333333-33433333333333333333333333333333333333333333333333331333333333333333333333333333324333333332333333333333333333333333333333333333333333333333333333333333333333333333333332222222222222232222222-33323322223323332224234443434232 3422555-72222233343334433343344333333444444333533432323334333343334314444344414443444345-3433333333333355424B6847675B344245475474g*62756544294593255226216444447FG47463846B74545444g4545457AC4554496955 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MANTYKETMNLPKTDFAMRANLPESEPKRLAKWEEEHIYEQVLEKNKDGKPFILHDGPPY:Sequence :EEEEccEEEEEEEEEEEEcccHHHHHHHHHHHHHHHTccccccccccTTcEEEEEEcccc:Sec Str : ##:PROS|59->70|PS00178|AA_TRNA_LIGASE_I|PDOC00161| : ==============:RP:SCP|47->204|1iq0A2|9e-31|10.8|158/366|c.26.1.1 : ========================================================:BL:SWS|5->935|SYI_MOOTA|0.0|50.8|902/930 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|32->654|PF00133|e-155|49.1|581/593|tRNA-synt_1 61: . . . * . .: 120 :ANGPIHIGHAFNKILKDFVNKSHAQRGFFTPYVPGWDCHGQPIEHMVEKTLGPDKMAKID:Sequence :ccccccHHHHHHHHHHHHHHHHHHHTTcEEEcccccccccHHHHHHHHHTccTTTTTTHH:Sec Str :########## :PROS|59->70|PS00178|AA_TRNA_LIGASE_I|PDOC00161| :============================================================:RP:SCP|47->204|1iq0A2|9e-31|10.8|158/366|c.26.1.1 :============================================================:BL:SWS|5->935|SYI_MOOTA|0.0|50.8|902/930 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|32->654|PF00133|e-155|49.1|581/593|tRNA-synt_1 121: . . + . . .: 180 :QPTLRRLCREWAEKYVDVQREGFKRLGVNADWEHPYLTFTPNYEAGNVEVFKRMYLDGSV:Sequence :HHHHTccHHHHHHHHHHHHHHHHHHTTccccGGGcccTTcHHHHHHHHHHHHHHHHTTcE:Sec Str :============================================================:RP:SCP|47->204|1iq0A2|9e-31|10.8|158/366|c.26.1.1 :============================================================:BL:SWS|5->935|SYI_MOOTA|0.0|50.8|902/930 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|32->654|PF00133|e-155|49.1|581/593|tRNA-synt_1 181: . * . . . .: 240 :YRGRKPIHWCKRCHTALAEAEIEYSDETSPSIFVKFKMDIMPGMFETAGAAGDAYVLIWT:Sequence :EEEEEEEEEETTTTEEEcGGGcTTcEEEEEEEEEcGGTTTTccccHHHHHHHHHHHcEEE:Sec Str :======================== :RP:SCP|47->204|1iq0A2|9e-31|10.8|158/366|c.26.1.1 : ===================================:RP:SCP|206->409|1ffyA2|7e-54|40.4|193/194|b.51.1.1 :============================================================:BL:SWS|5->935|SYI_MOOTA|0.0|50.8|902/930 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|32->654|PF00133|e-155|49.1|581/593|tRNA-synt_1 241: + . . . . *: 300 :TTPWTLPANTAVSLAPDADYVMVQADGSNMIMARELVEQVAEIAGWESYDLVRGEDGEPV:Sequence :ccGGGGGGccEEEEcTTcTHHHHcccHHHHHHHHHHHHHHHHccHHHHTTcTTHHHGcGG:Sec Str :============================================================:RP:SCP|206->409|1ffyA2|7e-54|40.4|193/194|b.51.1.1 :============================================================:BL:SWS|5->935|SYI_MOOTA|0.0|50.8|902/930 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|32->654|PF00133|e-155|49.1|581/593|tRNA-synt_1 301: . . . . + .: 360 :ALKGREFTGLTYTCPVRQDLKGTIIYGDHVTLDSGTGAVHTAPGHGQDDYLVALEFDVPL:Sequence :GccccEEEEEEEEcTGTTccEEEEEEcTTccTTcTTcEEEEcGGGcHHHHHHHHHTTccc:Sec Str :============================================================:RP:SCP|206->409|1ffyA2|7e-54|40.4|193/194|b.51.1.1 :============================================================:BL:SWS|5->935|SYI_MOOTA|0.0|50.8|902/930 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|32->654|PF00133|e-155|49.1|581/593|tRNA-synt_1 361: . . . * . .: 420 :LMPVDDNGVLTDEAGPFAGLDVDEANPVIIEWLRERGTLVAQKEILHSYPHCWRCHEPVI:Sequence :cccEcccccEEcccGGGTTccHHHHHHHHHHHHHHHTcEEEEEEccccccccEEcccccH:Sec Str :================================================= :RP:SCP|206->409|1ffyA2|7e-54|40.4|193/194|b.51.1.1 : ==============:RP:SCP|407->665|1li5A2|2e-22|14.3|252/299|c.26.1.1 :============================================================:BL:SWS|5->935|SYI_MOOTA|0.0|50.8|902/930 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|32->654|PF00133|e-155|49.1|581/593|tRNA-synt_1 421: . . + . . .: 480 :FRATDQWFVSMDKNSLRENALKAIENDVEWIPAWASNRIGSMVADRPDWCISRQRSWGVP:Sequence :HccccEEEETTTEEEcccTTccccccccccHHHHHccccccGGGGcHHHHEEEccccccE:Sec Str :============================================================:RP:SCP|407->665|1li5A2|2e-22|14.3|252/299|c.26.1.1 :============================================================:BL:SWS|5->935|SYI_MOOTA|0.0|50.8|902/930 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|32->654|PF00133|e-155|49.1|581/593|tRNA-synt_1 481: . * . . . .: 540 :IPVFKCAKCGSTVANEQTFDAVIDLFYREGADAWFTREPSEYLPRGVKCETCGCTELTPE:Sequence :ETTTHHHHTTcETTcccccccHHHHHHHccccEEEEcGGGTTTHHHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|407->665|1li5A2|2e-22|14.3|252/299|c.26.1.1 :============================================================:BL:SWS|5->935|SYI_MOOTA|0.0|50.8|902/930 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|32->654|PF00133|e-155|49.1|581/593|tRNA-synt_1 541: + . . . . *: 600 :KDILDVWWESGVSHTSVLKHREAEGLRFPADMYLEGSDQHRGWFQSSLLTSMGAYGVPPY:Sequence :HHTTcccccccccccEEcccEEEcEEEETTEEEccHHHHHHHcccccEEEHHHHHHTTcE:Sec Str :============================================================:RP:SCP|407->665|1li5A2|2e-22|14.3|252/299|c.26.1.1 :============================================================:BL:SWS|5->935|SYI_MOOTA|0.0|50.8|902/930 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|32->654|PF00133|e-155|49.1|581/593|tRNA-synt_1 601: . . . . + .: 660 :KAVMHCGFTVDGEGRKMSKSLGNGVDPAEVMAKSGADVLRLWVASVDYSQDVSISDEILQ:Sequence :EEEcTTccEEEEEcccccTTTTccccHHHHHHHccHHHHHHHHHcccTTccEEEcHHHHH:Sec Str :============================================================:RP:SCP|407->665|1li5A2|2e-22|14.3|252/299|c.26.1.1 :============================================================:BL:SWS|5->935|SYI_MOOTA|0.0|50.8|902/930 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|32->654|PF00133|e-155|49.1|581/593|tRNA-synt_1 661: . . . * . .: 720 :RTSEAYRRIRNTFRFLLGSLDDFDDQKDAVSDWNALEPLDQWAMVRTKHLLDDVSAAYDA:Sequence :HHHHHHHHHHHHHHHTHHHHHTcccccccEEcTTTccTHHHHHHHHHHHHHHHHHHHHHT:Sec Str :===== :RP:SCP|407->665|1li5A2|2e-22|14.3|252/299|c.26.1.1 : =======================================================:RP:SCP|666->942|1ffyA1|3e-66|33.5|263/273|a.27.1.1 :============================================================:BL:SWS|5->935|SYI_MOOTA|0.0|50.8|902/930 : $$$$$$$$$$$$$$$$$$$$$:RP:PFM|700->859|PF08264|8e-23|37.2|145/153|Anticodon_1 721: . . + . . .: 780 :YKFHYVYRAVYDYIVNDLSAVYMDATKDRLYSEAPDSPRRRAVQTVLMNILEVLVRVLAP:Sequence :TcHHHHHHHHHHHHHHHHHHHHHccccHHHHHTTccHHHHHHHHHHHHHHHHHHHHHHTT:Sec Str :============================================================:RP:SCP|666->942|1ffyA1|3e-66|33.5|263/273|a.27.1.1 :============================================================:BL:SWS|5->935|SYI_MOOTA|0.0|50.8|902/930 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|700->859|PF08264|8e-23|37.2|145/153|Anticodon_1 781: . * . . . .: 840 :VLSFTTDEVWEHYPQAMRERAGRPTNVQLAGWPKASDFAPAIPADGERVSEDFGVIMGVR:Sequence :TcHHHHHHHHHTTcccccccHTTcccGGGTccccccccccHHHHccccEEEEEEETTEEE:Sec Str :============================================================:RP:SCP|666->942|1ffyA1|3e-66|33.5|263/273|a.27.1.1 :============================================================:BL:SWS|5->935|SYI_MOOTA|0.0|50.8|902/930 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|700->859|PF08264|8e-23|37.2|145/153|Anticodon_1 841: + . . . . *: 900 :EVVTKALEDARGQKVVNKSQEAAVVVTAPRAVLDAVERYDAAVFEELFIVASVSFAEGEE:Sequence :EEEEEcccccHHHHHHHHTTccccHHHHHHHHHHHHHHHHHHHHHTcHHHHHHHTHHHHH:Sec Str :============================================================:RP:SCP|666->942|1ffyA1|3e-66|33.5|263/273|a.27.1.1 :============================================================:BL:SWS|5->935|SYI_MOOTA|0.0|50.8|902/930 :$$$$$$$$$$$$$$$$$$$ :RP:PFM|700->859|PF08264|8e-23|37.2|145/153|Anticodon_1 901: . . . . + .: 960 :LAATVSKTEAEKCPRCWNHRALGGNANHGSVCERCGDALDAIGFAEGE :Sequence :HHHHHHHHHHHHHHTcccccTcccccccTTccEEEEccTTcEEEEc :Sec Str :========================================== :RP:SCP|666->942|1ffyA1|3e-66|33.5|263/273|a.27.1.1 :=================================== :BL:SWS|5->935|SYI_MOOTA|0.0|50.8|902/930