[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "elen0:ACV55587.1"

            "recA protein"
            ""

OrgPattern ---------------------------------1---------------------------------- 2221111111111111111-11111111111111111111111311111111111111111111111111111111111111111111111111111--111111111111111111111111111111111111111111111117111111111111111111111111111111111111311111111111-122112112211211111121121111111111111111111111111111111111111122111111111221111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111121111111211111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111332232111111111111111111111111111111111111111111111111111111111111111111------11111111111111111-11-11111111111111111111111111111111111211111111111111122212222111--11111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111--11111111111111-1111--211-11111111111111111111111111111111 ----1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-31-1---336-4----211- ----------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR:Sequence : ===========================================================:RP:SCP|2->268|1g18A1|1e-29|54.2|249/250|c.37.1.11 : ==========================================================:BL:SWS|3->324|RECA_HELMI|e-105|63.4|322/346 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|21->294|PF00154|6e-94|63.0|273/274|RecA 61: . . . * . .: 120 :IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD:Sequence :============================================================:RP:SCP|2->268|1g18A1|1e-29|54.2|249/250|c.37.1.11 :============================================================:BL:SWS|3->324|RECA_HELMI|e-105|63.4|322/346 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|21->294|PF00154|6e-94|63.0|273/274|RecA 121: . . + . . .: 180 :TGEQALEICDMLVRSGAIDAVVVDSVAALVPRAEIEGEIGDTTVGLQARLMSQALRKLAG:Sequence : XXXXXXXXXXXXXX :SEG|137->150|aidavvvdsvaalv :============================================================:RP:SCP|2->268|1g18A1|1e-29|54.2|249/250|c.37.1.11 :============================================================:BL:SWS|3->324|RECA_HELMI|e-105|63.4|322/346 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|21->294|PF00154|6e-94|63.0|273/274|RecA 181: . * . . . .: 240 :SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFSSVRIDIRRIDSIKKDGEIVGN:Sequence : XXXXXXXXXXXXXXXX :SEG|219->234|ssvridirridsikkd : X:SEG|240->254|nrvrakvvknkvapp : ######### :PROS|214->222|PS00321|RECA_1|PDOC00131| :============================================================:RP:SCP|2->268|1g18A1|1e-29|54.2|249/250|c.37.1.11 :============================================================:BL:SWS|3->324|RECA_HELMI|e-105|63.4|322/346 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|21->294|PF00154|6e-94|63.0|273/274|RecA 241: + . . . . *: 300 :RVRAKVVKNKVAPPFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ:Sequence :XXXXXXXXXXXXXX :SEG|240->254|nrvrakvvknkvapp :============================ :RP:SCP|2->268|1g18A1|1e-29|54.2|249/250|c.37.1.11 : ================================:RP:SCP|269->325|1g18A2|2e-13|52.6|57/60|d.48.1.1 :============================================================:BL:SWS|3->324|RECA_HELMI|e-105|63.4|322/346 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|21->294|PF00154|6e-94|63.0|273/274|RecA 301: . . . . + .: 360 :GREAAKQTLKENPDLREELETKVRESFEIPIITRSTEEADAMSPVAKPAKKK :Sequence :========================= :RP:SCP|269->325|1g18A2|2e-13|52.6|57/60|d.48.1.1 :======================== :BL:SWS|3->324|RECA_HELMI|e-105|63.4|322/346