[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACV55587.1 elen0 ACV55587.1 "recA protein"
MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGR
IVEVYGPESSGKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPD
TGEQALEICDMLVRSGAIDAVVVDSVAALVPRAEIEGEIGDTTVGLQARLMSQALRKLAG
SLSKSNTTCIFINQLREKIGVMFGNPETTTGGRALKFFSSVRIDIRRIDSIKKDGEIVGN
RVRAKVVKNKVAPPFRQAEFDLMYGEGISREGCIVDMAVEAGVAKKSGAWYTYGEERLGQ
GREAAKQTLKENPDLREELETKVRESFEIPIITRSTEEADAMSPVAKPAKKK
//