[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "elen0:ACV55591.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ------------------------------------------------------------------------------1111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTFGTILREARERKGYDLATAARRLRIRPDILRAIEEDDFSRMPPRGYARNMVNAYARLV:Sequence :HHHHHHHHHHHHHTTccHHHHHHHHHHHcGGGcHHHHHHHHTTcccHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|1->66|2o38A1|6e-07|14.8|61/89|a.35.1.13 :============================================================:BL:SWS|1->75|RODZ_SERP5|6e-07|36.0|75/323 61: . . . * . .: 120 :GLNPTEMTRMYLDEAYAYQVGRARNGAQPSGFDRGGSSRTGRSTSRQGARPSQQVDERPP:Sequence :HHHHHHHHHHcccc :Sec Str : XXXXXXXXXXXXXXXXXXXXX :SEG|90->110|sgfdrggssrtgrstsrqgar :====== :RP:SCP|1->66|2o38A1|6e-07|14.8|61/89|a.35.1.13 :=============== :BL:SWS|1->75|RODZ_SERP5|6e-07|36.0|75/323 121: . . + . . .: 180 :RQNAFGRTMYDDRRDYGRDYGARGGSERLYSEGRTHPSRHAALPNAEYTNFYAGPKASSV:Sequence : :Sec Str : XXXXXXXXXXXXXXXX :SEG|130->145|yddrrdygrdygargg 181: . * . . . .: 240 :VQSKLPFVIAGGVILVLLIVVLVLVFGNNGGSSNEDVTKLPVTGLADPTQDGSGTEGGET:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXXXXXXXXX :SEG|187->211|fviaggvilvllivvlvlvfgnngg 241: + . . . . *: 300 :PAQPQAEPVETAPTSIKVTYTIAKDTPVYAVITKDGTSEDQMFSGGEEDTVELAEGDVWT:Sequence : :Sec Str 301: . . . . + .: 360 :FAAWASDGVTIKVDGEAVKFDGSDPATGMPMATVDFDAYLEKWYEDHPDAKKKGSADADA:Sequence : :Sec Str : XXXXXXXXXXXX:SEG|349->374|dakkkgsadadaadkaaedgaktgdg 361: . . . * . .: 420 :ADKAAEDGAKTGDGTSAA :Sequence : :Sec Str :XXXXXXXXXXXXXX :SEG|349->374|dakkkgsadadaadkaaedgaktgdg