[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACV55591.1 elen0 ACV55591.1 "conserved hypothetical protein"
MTFGTILREARERKGYDLATAARRLRIRPDILRAIEEDDFSRMPPRGYARNMVNAYARLV
GLNPTEMTRMYLDEAYAYQVGRARNGAQPSGFDRGGSSRTGRSTSRQGARPSQQVDERPP
RQNAFGRTMYDDRRDYGRDYGARGGSERLYSEGRTHPSRHAALPNAEYTNFYAGPKASSV
VQSKLPFVIAGGVILVLLIVVLVLVFGNNGGSSNEDVTKLPVTGLADPTQDGSGTEGGET
PAQPQAEPVETAPTSIKVTYTIAKDTPVYAVITKDGTSEDQMFSGGEEDTVELAEGDVWT
FAAWASDGVTIKVDGEAVKFDGSDPATGMPMATVDFDAYLEKWYEDHPDAKKKGSADADA
ADKAAEDGAKTGDGTSAA
//