[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "elen0:ACV55619.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MARKDDFDWLDDPFDEKKAAKDEMRAATSGGTKLALGCGCLIAVVGIVVLLGFVLVNMAE:Sequence : XXXXXXXXXXX :SEG|5->15|ddfdwlddpfd : XXXXXXXXXXXXXXXXXXXX :SEG|37->56|gcgcliavvgivvllgfvlv 61: . . . * . .: 120 :IMAS :Sequence