[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACV55619.1 elen0 ACV55619.1 "hypothetical protein"
MARKDDFDWLDDPFDEKKAAKDEMRAATSGGTKLALGCGCLIAVVGIVVLLGFVLVNMAE
IMAS
//