[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "elen0:ACV55743.1"

            "Phosphoglycerate kinase"
            ""

OrgPattern 11111111111111111111111111111111111111111112212111221111111111111-11 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111--1111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111121111111111111111111211111111121111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111-------------111111111111111111111111111111111111111213211111121111211211111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1-11111111112111111111211111111111 1111111-43411111111111111111111111111111111111111111111111111111111111121111111111111111-12111112111111212117121112122212222232515G3-3242222211432122212252111112-22112211211111222O2123384671433532212 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MAEIKTIDELDARGKRVLVRVDFNVPVKDGAVTDDTRIRAALPTIQKLVDDGARVILMSH:Sequence :ccccccGGGcccTTcEEEEEcccccccccccccccHHHHTTHHHHHHHHHTTccEEEEcc:Sec Str : ########### :PROS|16->26|PS00111|PGLYCERATE_KINASE|PDOC00102| : ========================================================:RP:SCP|5->394|13pkA|e-139|45.9|388/415|c.86.1.1 : ========================================================:BL:SWS|5->394|PGK_GEOKA|e-119|55.3|389/394 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->385|PF00162|e-126|59.9|379/383|PGK 61: . . . * . .: 120 :LGRPAGEGFEESFTLRPAAQKLSELMGKPVVFATDTVGDDARAKAASLRDGDVLVVENLR:Sequence :ccccTTcccHHHHccHHHHHHHHHHHTcccEEccccccHHHHHHTTcccTTEEEEcccGG:Sec Str :============================================================:RP:SCP|5->394|13pkA|e-139|45.9|388/415|c.86.1.1 :============================================================:BL:SWS|5->394|PGK_GEOKA|e-119|55.3|389/394 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->385|PF00162|e-126|59.9|379/383|PGK 121: . . + . . .: 180 :FDKREKKNDPAFCEELAALGEAYVNDAFGTAHRAHASTAGVAALLPAYAGYLMQREVATL:Sequence :GcEccHHHHHHHHHHHHTTccEEEEccGGGTTcccHHHHcccccccEEEcHHHHHHHHHH:Sec Str :============================================================:RP:SCP|5->394|13pkA|e-139|45.9|388/415|c.86.1.1 :============================================================:BL:SWS|5->394|PGK_GEOKA|e-119|55.3|389/394 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->385|PF00162|e-126|59.9|379/383|PGK 181: . * . . . .: 240 :SGMLEEPRRPFTAILGGSKVSDKIKVIDALMDKCDTLIIGGGMCFTFLLAQGKAVGTSLK:Sequence :HHHHHcccccEEEEEEccccTTcHHHHHHHHTTccEEEEEGGGHHHHHHHHccccTTccc:Sec Str :============================================================:RP:SCP|5->394|13pkA|e-139|45.9|388/415|c.86.1.1 :============================================================:BL:SWS|5->394|PGK_GEOKA|e-119|55.3|389/394 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->385|PF00162|e-126|59.9|379/383|PGK 241: + . . . . *: 300 :EEDWVERAAAMIAKAEERGVQLLLPVDVVCADRFAEDAETLTVSVDGIPGDMMGLDIGPE:Sequence :cHHHHHHHHHHHHHHHHTTcEEEcccEEEEEccccTTccEEEEETTcccTTcEEEEEcHH:Sec Str :============================================================:RP:SCP|5->394|13pkA|e-139|45.9|388/415|c.86.1.1 :============================================================:BL:SWS|5->394|PGK_GEOKA|e-119|55.3|389/394 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->385|PF00162|e-126|59.9|379/383|PGK 301: . . . . + .: 360 :TAKLYADAVAQAKTVFWNGPMGVFEMKAFEAGTKAVAEAVAANADADTIIGGGDSVAAVN:Sequence :HHHHHHHHHHHccEEEEEcccccTTcGGGHHHHHHHHHHHHHHTTcEEEEcccccTTcEE:Sec Str : XXXXXXXXXXXXXXXXXXX :SEG|330->348|eagtkavaeavaanadadt :============================================================:RP:SCP|5->394|13pkA|e-139|45.9|388/415|c.86.1.1 :============================================================:BL:SWS|5->394|PGK_GEOKA|e-119|55.3|389/394 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->385|PF00162|e-126|59.9|379/383|PGK 361: . . . * . .: 420 :KFDLAEQMTFISTGGGASMELVQGEALPGVEALK :Sequence :EEccTTcccEEcccHHHHHHHHTTcccHHHHTcc :Sec Str :================================== :RP:SCP|5->394|13pkA|e-139|45.9|388/415|c.86.1.1 :================================== :BL:SWS|5->394|PGK_GEOKA|e-119|55.3|389/394 :$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|6->385|PF00162|e-126|59.9|379/383|PGK