[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACV55743.1 elen0 ACV55743.1 "Phosphoglycerate kinase"
MAEIKTIDELDARGKRVLVRVDFNVPVKDGAVTDDTRIRAALPTIQKLVDDGARVILMSH
LGRPAGEGFEESFTLRPAAQKLSELMGKPVVFATDTVGDDARAKAASLRDGDVLVVENLR
FDKREKKNDPAFCEELAALGEAYVNDAFGTAHRAHASTAGVAALLPAYAGYLMQREVATL
SGMLEEPRRPFTAILGGSKVSDKIKVIDALMDKCDTLIIGGGMCFTFLLAQGKAVGTSLK
EEDWVERAAAMIAKAEERGVQLLLPVDVVCADRFAEDAETLTVSVDGIPGDMMGLDIGPE
TAKLYADAVAQAKTVFWNGPMGVFEMKAFEAGTKAVAEAVAANADADTIIGGGDSVAAVN
KFDLAEQMTFISTGGGASMELVQGEALPGVEALK
//