[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "elen0:ACV55872.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ------------------------------------------------------------------------------11111-----------------------------------------------------11111---11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSELLNQLWTPELQAAFTVVVVLLVILYVLSIVWVVRDAYLRGSYWYVWAIVALVPLLGI:Sequence : XXXXXXXXXXXXXXXXXX :SEG|19->36|vvvvllvilyvlsivwvv 61: . . . * . .: 120 :IAYCLLRPPLLQIDRDEQELEIALKQRELMKYGECANCGYPVEADFVLCPNCHQRLKNLC:Sequence : ==========================:BL:SWS|95->137|Y416_METJA|2e-05|37.2|43/190 121: . . + . . .: 180 :GTCNHALDPTWTVCPYCATPVAGGPRTRRAPQQRGARTQQPQQAATQQQTRQARPAQSEH:Sequence : XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|143->177|ggprtrrapqqrgartqqpqqaatqqqtrqarpaq :================= :BL:SWS|95->137|Y416_METJA|2e-05|37.2|43/190 181: . * . . . .: 240 :GVQ :Sequence