[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "elen0:ACV55893.1"

            "trigger factor"
            ""

OrgPattern -------------------------------------------------------------------- 111-111111111111111-111111111111111111111111111111111111111111111111111111111111221-----------------------------------------------1--------111111111111111111111-111111111111--1111--111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111122111111111111111-11111-11111111111111111111111111111-11111111111-111111111111111111111111111111111111111-111--1---------111111111-111-1-11111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111----------------1--1--1-11111-11111111111111111111111111--11111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--11111111111-11111111111111111111111111111111111111111111111111111111111111111111111111-1-11-------111--1111111-1111-111111--------------------------------111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------1--1---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MMEDSYVETKVEALEDNRTKVTVTVDAADIDARIKKTYKDFANKYNFPGFRKGKAPRPII:Sequence : ccEEEEEEccTccEEEEEcccGGGTHHHHHHHHHHHHTTcccTTccTTccccTTH:Sec Str :############################################################:PROS|1->122|PS00430|TONB_DEPENDENT_REC_1|PDOC00354| : =====================================================:RP:SCP|8->123|1omsA|3e-22|28.9|114/115|d.241.2.1 : ======================================================:BL:SWS|7->375|TIG_BACSK|4e-41|29.9|355/434 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->152|PF05697|2e-20|37.2|145/146|Trigger_N 61: . . . * . .: 120 :DNALGAEAVRATVTDDVVNGTYPLAIDDCDLYPIAKPEFDETDLVEAGKPYTFSFTVTVK:Sequence :HHHTTTTccHHHHHHHHHHHHHHHHHHHccccccccEEccccccccccccccEEEEEEcc:Sec Str :############################################################:PROS|1->122|PS00430|TONB_DEPENDENT_REC_1|PDOC00354| :============================================================:RP:SCP|8->123|1omsA|3e-22|28.9|114/115|d.241.2.1 :============================================================:BL:SWS|7->375|TIG_BACSK|4e-41|29.9|355/434 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->152|PF05697|2e-20|37.2|145/146|Trigger_N 121: . . + . . .: 180 :PEIEISSYEPVEIELPAEGTTDAEIDEQIDALREHYYSFEDASAATKVKEDSYIDLAMKA:Sequence :cccccTTcTTcEEEccccccccccccccccccccccccccEcccEEEEcccccccccccc:Sec Str :## :PROS|1->122|PS00430|TONB_DEPENDENT_REC_1|PDOC00354| :=== :RP:SCP|8->123|1omsA|3e-22|28.9|114/115|d.241.2.1 :============================================================:RP:SCP|121->231|1jvwA|5e-07|11.0|109/160|d.26.1.1 :============================================================:BL:SWS|7->375|TIG_BACSK|4e-41|29.9|355/434 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|7->152|PF05697|2e-20|37.2|145/146|Trigger_N 181: . * . . . .: 240 :TDDKGEEIPSLTTENRPYGLGANLFPAEFDEQLVGLKKGQTATFTLDMPADPPIMLSALA:Sequence :ccccTTccccccTTccTTccccccccTTccccccEEEEccHHHHTTcGGGGTTcccTTTc:Sec Str :=================================================== :RP:SCP|121->231|1jvwA|5e-07|11.0|109/160|d.26.1.1 :============================================================:BL:SWS|7->375|TIG_BACSK|4e-41|29.9|355/434 241: + . . . . *: 300 :GKTEKINFEVEVKVVKKKIVPEVNDEWAKEQMGFESVEDLRARIAESVTSQKADMMPRLK:Sequence :ccEEEEEEcccEEEEEEEEcccccTGGGGGcTTTTHHHHHHHHHHHHHHHHHHHHHHHHH:Sec Str : XXXXXXXXXXXXXXXXXXXXX :SEG|244->264|ekinfevevkvvkkkivpevn : ====================================:RP:SCP|265->444|1w26A1|4e-11|17.6|170/185|a.223.1.1 :============================================================:BL:SWS|7->375|TIG_BACSK|4e-41|29.9|355/434 : $$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|277->429|PF05698|8e-12|30.7|153/161|Trigger_C 301: . . . . + .: 360 :ENACLYALAERVEGDVPEAMLEDAEASLIQDFFQQLQSQGMTFDVYLAQQGITPDQFKED:Sequence :TTT cTTccccccEEEcHHHHHHHHHHHHH :Sec Str :============================================================:RP:SCP|265->444|1w26A1|4e-11|17.6|170/185|a.223.1.1 :============================================================:BL:SWS|7->375|TIG_BACSK|4e-41|29.9|355/434 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|277->429|PF05698|8e-12|30.7|153/161|Trigger_C 361: . . . * . .: 420 :VKKQAEDMSKQDLALDAWARHFGMEATAEEVTEEFVKSGVEDPAALEAEWRSNGQLHMVR:Sequence : :Sec Str : XXXXXXXXXXXX :SEG|385->396|eataeevteefv :============================================================:RP:SCP|265->444|1w26A1|4e-11|17.6|170/185|a.223.1.1 :=============== :BL:SWS|7->375|TIG_BACSK|4e-41|29.9|355/434 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|277->429|PF05698|8e-12|30.7|153/161|Trigger_C 421: . . + . . .: 480 :QGVIRTKAVKDIMDKAVVTELDLSKKKDEEKKPAKKAAAKKTAKKDEAAGDEPAKKPAKK:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX:SEG|445->500|kkkdeekkpakkaaakktakkdeaagdepakkpakkaapkkaakkdedveakadda :======================== :RP:SCP|265->444|1w26A1|4e-11|17.6|170/185|a.223.1.1 :$$$$$$$$$ :RP:PFM|277->429|PF05698|8e-12|30.7|153/161|Trigger_C 481: . * . . . .: 540 :AAPKKAAKKDEDVEAKADDAE :Sequence : :Sec Str :XXXXXXXXXXXXXXXXXXXX :SEG|445->500|kkkdeekkpakkaaakktakkdeaagdepakkpakkaapkkaakkdedveakadda