[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "elen0:ACV55965.1"

            "CopG family protein"
            ""

OrgPattern -------------------------------------------------------------------- ---------------------------------------------------------------------------11---1----------------------------------------------2-1---2----------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------1-----------1-1----1-------1------------------------------1---------------------------------------2--1----------------------------------------------------------------------------------------------------------1------------------------------------------------------1---1-11------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSNEKITSENLEELFDEGCDVTGFFDFDSAVVVEGRTETKRVNVDMPIWMVEALDKEAKR:Sequence : cccccccccccccHHHHHHHHHHHHH:Sec Str : ========================:RP:SCP|37->85|1bazA|2e-05|22.4|49/49|a.43.1.1 61: . . . * . .: 120 :VGIGRQAVIKMWLAERLDEEARRSA :Sequence :HTccHHHHHHHHHHHHTTccccccc :Sec Str :========================= :RP:SCP|37->85|1bazA|2e-05|22.4|49/49|a.43.1.1