[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACV55965.1 elen0 ACV55965.1 "CopG family protein"
MSNEKITSENLEELFDEGCDVTGFFDFDSAVVVEGRTETKRVNVDMPIWMVEALDKEAKR
VGIGRQAVIKMWLAERLDEEARRSA
//