[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "elen0:ACV55970.1"

            "iojap-like protein"
            ""

OrgPattern -------------------------------------------------------------------- 1111111111111111111-111111111111111111111111-1111111111111--1111111111111111111111111111111111--1--1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111------------11------1-11-11111111111-11111111-11211111-11-1111111111111111111111111-------1-111-111-11111111111-1111111111111111111-1111-1111111111----1111111111111111111111111111111111111111111111111111111111111111111111111111111--111111111111111111111--1111111111111111111111-------------------------1111111111-111111111111111111111--1111-------11----11--1111-11-1121111111111111111111--11111111111111111111-1---1-1-11111111111111-1---1-11111111-1111111111111111111111111111111111111111111111111-11111111111111111111--------11111-11--1111------------------------------------11-1-11111111 --------------1-----------------------------------------------------------------------------------------11--1-------1---11--11-1-141-1111---1-11--1---1-1--11-1----------------2--17211211112-11-1----- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSTTTTEKTSRECALIAACAADEKKATDIMVQEVRDLIGVTDYFVIATASNNRQVEAIID:Sequence : ccHHHHHHHHHHHHHTTcEEEEEEEcGGTcTTccEEEEEEEccHHHHHHHHH:Sec Str : ==================================================:RP:SCP|11->117|2id1A1|3e-31|32.1|106/120|d.218.1.12 : ===============================================:BL:SWS|14->120|IOJAP_MAIZE|1e-16|41.0|105/228 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|20->112|PF02410|8e-19|45.7|92/99|DUF143 61: . . . * . .: 120 :EIEDAVRTKAQMKPLHREGTQDGTWSLLDYGSFVVHVFQPETREYYRLEALWNDAPVIDL:Sequence :HHHHHHHHTTcccEEccEcTTTTcEEEEEcccEEEEEEETTcGGGTcTTTcc ccccc:Sec Str :========================================================= :RP:SCP|11->117|2id1A1|3e-31|32.1|106/120|d.218.1.12 :============================================================:BL:SWS|14->120|IOJAP_MAIZE|1e-16|41.0|105/228 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|20->112|PF02410|8e-19|45.7|92/99|DUF143 121: . . + . . .: 180 :AAEAGLTDIEYSDRIAKMLGKE :Sequence : :Sec Str