[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACV55970.1 elen0 ACV55970.1 "iojap-like protein"
MSTTTTEKTSRECALIAACAADEKKATDIMVQEVRDLIGVTDYFVIATASNNRQVEAIID
EIEDAVRTKAQMKPLHREGTQDGTWSLLDYGSFVVHVFQPETREYYRLEALWNDAPVIDL
AAEAGLTDIEYSDRIAKMLGKE
//