[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "elen0:ACV56026.1"

            "Hydroxyethylthiazole kinase"
            ""

OrgPattern -----------------1-----1----1--112----1111111111--111-111---1------- -------1111--------------------------1--------11111------------1-------11111-1-11-1------------------------1---------111--------------1-11111---1----------------------------------------------11111111111111111111111111111112111111111-11111111111111-111111-1-11-1---1111111-112-111111-------22222222222--------------11---111--1111222222212111111111-1-111-1-11111-1-111111-1--1------------------------------------------------1---11-111-----------1--1-------------------------------------------------------------------------------------------1-------1-------------------------11111111--111----------------11----------1--111111----------1-------1--------------------------------111111-1111111111-111111111111111111111111---111111111111111111111111--1--------------------------------1---111111-11111111--1-----------------------------1111-----111-------------------1111111------------------------------------------------1 1-------1----11-111111111111111-111111111111-111111111--111111111111-111111111-111111111-1211111111-111111---1------------------------------------------------------------------11-----112-21-12------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MEPFALKRALDNVRATTPLVHNITNYVTVNDCANALLAIGASPIMSDEPADVFDITSICG:Sequence :ccHHHHHHHHHHHHHHccEEEEEccTTTHHHHHHHHHHHTcEEEccccTTTHHHHHHHcc:Sec Str : ====================================================:RP:SCP|9->277|1c3qA1|1e-24|32.2|261/272|c.72.1.2 : =======================================================:BL:SWS|6->275|THIM_CLOAB|2e-61|44.1|270/273 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|10->266|PF02110|1e-37|40.7|246/246|HK 61: . . . * . .: 120 :GLTLNIGTLNERSIQGMFAAGERASELGHPIVLDPVGAGASALRTRTASDLLDKLAVSVV:Sequence :EEEEEcTTccHHHHHHHHHHHHHHHHTTccEEEEcTTcTTcHHHHHHHHHHHHHccccEE:Sec Str :============================================================:RP:SCP|9->277|1c3qA1|1e-24|32.2|261/272|c.72.1.2 :============================================================:BL:SWS|6->275|THIM_CLOAB|2e-61|44.1|270/273 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|10->266|PF02110|1e-37|40.7|246/246|HK 121: . . + . . .: 180 :RGNMSEAKALAGGAAATRGVDVCPGDAVTEDNLAAGAAFARDFAAKTGAVVAVTGAIDIV:Sequence :EEcHHHHHHHccHHHHHHHHHHHHHHTcEccccHHHHHHHHHHHHHHTcEEEEccccEEE:Sec Str : XXXXXXXXXX :SEG|127->136|akalaggaaa : XXXXXXXXXXXXXXXXXXXXXXXXXXX:SEG|154->183|aagaafardfaaktgavvavtgaidivada :============================================================:RP:SCP|9->277|1c3qA1|1e-24|32.2|261/272|c.72.1.2 :============================================================:BL:SWS|6->275|THIM_CLOAB|2e-61|44.1|270/273 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|10->266|PF02110|1e-37|40.7|246/246|HK 181: . * . . . .: 240 :ADAERAYAVRNGSPLMGRITGAGCMLSCVCAAFATANPDALLDATVAAVVGMGLAGQIAQ:Sequence :EccccEEEEccccGGGGGcTTHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHHHHH:Sec Str :XXX :SEG|154->183|aagaafardfaaktgavvavtgaidivada : XXXXXXXXXXXX :SEG|219->230|dalldatvaavv :============================================================:RP:SCP|9->277|1c3qA1|1e-24|32.2|261/272|c.72.1.2 :============================================================:BL:SWS|6->275|THIM_CLOAB|2e-61|44.1|270/273 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|10->266|PF02110|1e-37|40.7|246/246|HK 241: + . . . . *: 300 :GRMGGYDGNGSFRTYLLDALYNLDGDALEAGARVEELA :Sequence :HHHTTcTcHHHHHHHHHHHHHHccHHHHHHHccEEEc :Sec Str :===================================== :RP:SCP|9->277|1c3qA1|1e-24|32.2|261/272|c.72.1.2 :=================================== :BL:SWS|6->275|THIM_CLOAB|2e-61|44.1|270/273 :$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|10->266|PF02110|1e-37|40.7|246/246|HK