[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACV56026.1 elen0 ACV56026.1 "Hydroxyethylthiazole kinase"
MEPFALKRALDNVRATTPLVHNITNYVTVNDCANALLAIGASPIMSDEPADVFDITSICG
GLTLNIGTLNERSIQGMFAAGERASELGHPIVLDPVGAGASALRTRTASDLLDKLAVSVV
RGNMSEAKALAGGAAATRGVDVCPGDAVTEDNLAAGAAFARDFAAKTGAVVAVTGAIDIV
ADAERAYAVRNGSPLMGRITGAGCMLSCVCAAFATANPDALLDATVAAVVGMGLAGQIAQ
GRMGGYDGNGSFRTYLLDALYNLDGDALEAGARVEELA
//