[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "elen0:ACV56092.1"

            "ribosomal protein L11"
            ""

OrgPattern --1-11-1-1------1------1111111111111111111111111111111111111111-1-11 1111111111111111111-11111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111311111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111-11-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 ------------111------11--------------1-1-11--------------------111111-1111111-1111111-11-111-1-1111-1--1----3--------------------232-1--1---1-1111----1------1-----1---111----12222G222124224-32-131112 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MAEKKQTGFIKLQIPAGAANPAPPVGPALGAQGVNIMQFCQAFNAQTQDQSGTIIPVEIT:Sequence : cccccEEEEcccTTcccccTTTTTTTTTTcccTTccHHHHHHHGGGcccccccEEEE:Sec Str : XXXXXXXXXXXXXXXXXXX :SEG|15->33|pagaanpappvgpalgaqg : ===========================:RP:SCP|34->70|1mmsA2|2e-11|70.3|37/63|d.47.1.1 : ==========================================================:BL:SWS|3->142|RL11_STRSF|2e-40|68.6|140/144 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|10->67|PF03946|9e-08|41.4|58/60|Ribosomal_L11_N 61: . . . * . .: 120 :VYEDKSFTFVCKTPPAAVLIKEKLNINSGSGLPHVQPVGTLTEDQLREIAEIKMPDLNAN:Sequence :EcccccEEEEEccccTTHHHHHHHTcccccccTTTcccEEEcHHHHHHHHHHTcTTcccc:Sec Str :========== :RP:SCP|34->70|1mmsA2|2e-11|70.3|37/63|d.47.1.1 : =====================================================:RP:SCP|68->141|1hc8A|3e-22|62.2|74/74|a.4.7.1 :============================================================:BL:SWS|3->142|RL11_STRSF|2e-40|68.6|140/144 :$$$$$$$ :RP:PFM|10->67|PF03946|9e-08|41.4|58/60|Ribosomal_L11_N : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|72->140|PF00298|2e-14|58.0|69/69|Ribosomal_L11 121: . . + . . .: 180 :TIEAAMEIIAGTARSMGVRIEGREMKIKYVPSKKVAAMLQGKTLED :Sequence :cHHHHHHHHHHHHTTTTEEEcc :Sec Str :===================== :RP:SCP|68->141|1hc8A|3e-22|62.2|74/74|a.4.7.1 :====================== :BL:SWS|3->142|RL11_STRSF|2e-40|68.6|140/144 :$$$$$$$$$$$$$$$$$$$$ :RP:PFM|72->140|PF00298|2e-14|58.0|69/69|Ribosomal_L11