[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACV56092.1 elen0 ACV56092.1 "ribosomal protein L11"
MAEKKQTGFIKLQIPAGAANPAPPVGPALGAQGVNIMQFCQAFNAQTQDQSGTIIPVEIT
VYEDKSFTFVCKTPPAAVLIKEKLNINSGSGLPHVQPVGTLTEDQLREIAEIKMPDLNAN
TIEAAMEIIAGTARSMGVRIEGREMKIKYVPSKKVAAMLQGKTLED
//