[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "elen0:ACV56128.1"

            "ribosomal protein S14"
            ""

OrgPattern -------------------------------------------------------------------- 11111-1111111121111-12112211111221112122111121111-----------11112121121111121111111111111111-111---1111111111111111111111111-11111-11--1-11111111-1111--111111111111111---111111111111111111111112111111111111111113322111111111122222211111111111111111111121-11211212211222111211-11111122221111111111111122222222212221--1111111111111111111111111111111-11111-111111-1111111111-1111111111111-------------1111111111--11111111111-111111111111-1--111111111111111111111111-11111-----1111---------1--11111-11111111111111111111111111111111111111111111111111111111111-1111-11111-1-111-1111-11111111-1111111111111111111111111111--111111-1-111111111-11111-1111111111111111111--1-11111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111--111111111111--1111111-11-11111-------11-111111-111-----1---1111111111111------11111--------------111-1-121111111111111---11-111-1111111-11111111111111111111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---1------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MAKKSMVAKAKREPKFSTRQHNRCTRCGRPRAYYRKFGLCRVCLRELANKGELPGVTKAS:Sequence : ccHHHHHccccccccGGGcccccccccccccccTTTcccTTHHHHHHTTTccccccccc:Sec Str : ####################### :PROS|23->45|PS00527|RIBOSOMAL_S14|PDOC00456| : ===========================================================:RP:SCP|2->61|1fjgN|6e-22|66.7|60/60|g.39.1.7 :============================================================:BL:SWS|1->61|RS14Z_SYNAS|1e-25|72.1|61/61 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|18->60|PF00253|5e-10|69.8|43/55|Ribosomal_S14 61: . . . * . .: 120 :W :Sequence :c :Sec Str := :RP:SCP|2->61|1fjgN|6e-22|66.7|60/60|g.39.1.7 := :BL:SWS|1->61|RS14Z_SYNAS|1e-25|72.1|61/61