[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACV56128.1 elen0 ACV56128.1 "ribosomal protein S14"
MAKKSMVAKAKREPKFSTRQHNRCTRCGRPRAYYRKFGLCRVCLRELANKGELPGVTKAS
W
//