[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "elen0:ACV56185.1"

            "modD protein"
            ""

OrgPattern ---1-1-111111111-11--1111111-1-111111-22222111121222211111111-----11 11111-111111-111111-11111111111111111111111111111--111111-----1-1111111----111--11-1211111111111---1-111111111---------------2222223222211111111111121111111111111-1111111111111111111111-11-111111111111111111111111111111111-1111111-11---------------1----------------------------------------111111111111111111111111----------11-111111111-1111221111--1---1111221111111----1-1-1111111-----2122211122222----------1-11211111131-11111111111122111--1111111111111111-22-12121111111111--------------------1111211111111111111112211111111121121-1-31-1-11113111--1111111-11111111-112211-111111-111--111212111111111212112-------1111111112321122113111111111111111111111-111111---111------21111111222122211-111122212112211111111111111111111111111111111122221-1111111111111---111111----11111----1---1-----111111111111111111111111111111111111111111111111111111----------1111111-111111---------------------------------------111-111111 -----1------111----1111111-111111--11------1-1--1-1111-1--1111111--1-1--1-111111111111---211-1111111111111-1-12-211---1-111-11111151---1----1-11------1--11--11111-11--------2111114111111112-21111111- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MLRISDTRIDGFIAEDVPYVDLTCAVLGIGDEPGEMEYFTREDCVLAGANVVARIMGKLG:Sequence : TTHHHHHHHHHHHccccccHHHHHcHcccEEEEEEEEcccEEcccHHHHHHHHHHTT:Sec Str : =========================================================:RP:SCP|4->106|1ytdA2|2e-16|20.4|103/119|d.41.2.1 :============================================================:BL:SWS|1->279|MODD_ECO27|3e-41|31.5|279/284 61: . . . * . .: 120 :CDVVEARRDGERATAGEAFFRVRGTAGDLHAAWKVCLNVFDHMSAVATKTRAMVDAAHAE:Sequence :cEEEEcccTTcEEcTTccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHT:Sec Str :============================================== :RP:SCP|4->106|1ytdA2|2e-16|20.4|103/119|d.41.2.1 : ===============:RP:SCP|106->278|1o4uA1|1e-21|28.3|159/162|c.1.17.1 :============================================================:BL:SWS|1->279|MODD_ECO27|3e-41|31.5|279/284 : $$$$$$$$$$$$$$$:RP:PFM|106->275|PF01729|7e-19|38.9|167/169|QRPTase_C 121: . . + . . .: 180 :NPRCEVLTTRKSMPGAKDLLTEAVMAGGAFPHRLGLSETVLVFDHHLTFFGGFEAFVEQL:Sequence :TcccEEEccccccTTTHHHHHHHHHHHTcccccccTTccEEEccccTTccccHHHHHHHH:Sec Str :============================================================:RP:SCP|106->278|1o4uA1|1e-21|28.3|159/162|c.1.17.1 :============================================================:BL:SWS|1->279|MODD_ECO27|3e-41|31.5|279/284 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|106->275|PF01729|7e-19|38.9|167/169|QRPTase_C 181: . * . . . .: 240 :PDIKGRCVEKKLFVEADAERARVLARAGVDGIQVDKVPVDELEPLVRELRAIDPHVTLIA:Sequence :HHHHcHHTTccEEEEccHHHHHHHHHHTccEEEcccccHHHHHHHHHHHHHHcTcccEEE:Sec Str :============================================================:RP:SCP|106->278|1o4uA1|1e-21|28.3|159/162|c.1.17.1 :============================================================:BL:SWS|1->279|MODD_ECO27|3e-41|31.5|279/284 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|106->275|PF01729|7e-19|38.9|167/169|QRPTase_C 241: + . . . . *: 300 :AGGVNPQNAGAYAATGVDGLATTAPFSAKPLDMSVRMRPL :Sequence :EccccTTcccccccccccEEEcGGGTTcccccEEEEE :Sec Str :====================================== :RP:SCP|106->278|1o4uA1|1e-21|28.3|159/162|c.1.17.1 :======================================= :BL:SWS|1->279|MODD_ECO27|3e-41|31.5|279/284 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|106->275|PF01729|7e-19|38.9|167/169|QRPTase_C