[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACV56185.1 elen0 ACV56185.1 "modD protein"
MLRISDTRIDGFIAEDVPYVDLTCAVLGIGDEPGEMEYFTREDCVLAGANVVARIMGKLG
CDVVEARRDGERATAGEAFFRVRGTAGDLHAAWKVCLNVFDHMSAVATKTRAMVDAAHAE
NPRCEVLTTRKSMPGAKDLLTEAVMAGGAFPHRLGLSETVLVFDHHLTFFGGFEAFVEQL
PDIKGRCVEKKLFVEADAERARVLARAGVDGIQVDKVPVDELEPLVRELRAIDPHVTLIA
AGGVNPQNAGAYAATGVDGLATTAPFSAKPLDMSVRMRPL
//