[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACV56208.1 elen0 ACV56208.1 "hypothetical protein"
MQYANINDAQAAMTSDQYVGLNADGTYGLFDRAQNPQWVGACQYAYQVAGVPFPNGLYGV
GMTATATVEPAGKRKLFALLLWLFLGVWGGHDFYAGKKWLGVAHVLLFFAWLWMLFFGVL
IPINGYEFFAFLILLVLCAMTFVELLALLISSKYGECSRW
//