[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "elen0:ACV56217.1"

            "Patatin"
            ""

OrgPattern ---------------------------------------------3---------------------- -----1-1111112------------------------------------------1--------------12221111122------1111-1----------------------------------------------------------------------------------------------------112122122222222------222-------------111--------------------1-1--11111--------1------111----------------------------------111-------11-------1-11-11-111-1----2------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------1111---111111--1--------------------------------------------------------------------------------------------------------------------111-11--------1------------------------------------------------1----------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MMTSTVHDVALVFEGGGMRNSYSAGAIGVMLEQGLFFDDVYGLSAGATNAIDYVSRDARR:Sequence : ===================================================:RP:SCP|10->165|1oxwA|4e-16|13.5|155/360|c.19.1.3 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|11->169|PF01734|8e-08|30.3|155/182|Patatin 61: . . . * . .: 120 :NEASFTACLDDLSFRWWVMPFVDADGVGAALHGDARVRSSCALPFDFDAFQANPARVTLQ:Sequence :============================================================:RP:SCP|10->165|1oxwA|4e-16|13.5|155/360|c.19.1.3 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|11->169|PF01734|8e-08|30.3|155/182|Patatin 121: . . + . . .: 180 :AIDRDTGETVCFTRGDFPTEQTLMERVRASTSYPIVLPPTVVDGRALYDGGIGRGGGIMV:Sequence : XXXXXXXXX :SEG|170->178|ggigrgggi :============================================= :RP:SCP|10->165|1oxwA|4e-16|13.5|155/360|c.19.1.3 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|11->169|PF01734|8e-08|30.3|155/182|Patatin 181: . * . . . .: 240 :PRAMDDGLSRFFVVCTRPRGFRRPLKPNRFYDAFFWRRPRMREALDTWNRRYDAELDRLD:Sequence 241: + . . . . *: 300 :RLEAEGRAYVFYANDQGVKNTERDAEKLARNYERGRMQALSEFDRWERFLSGQGV :Sequence