[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "elen0:ACV56230.1"

            "FeS assembly ATPase SufC"
            ""

OrgPattern 43221311111111114154344451114144111111111111-11111222211222221213-11 --14821111111211122-211113222221211121433416212331123232111143312356641111122211214-----1111111111111111111111111111111111111----------1222231111211111111111221111111321211111222211114222223-121222222221222222221111222143113111111143111111111111111111211--11111-12111122111111111111111111111111111111111111111111111111111121--11----111-1-11111---31-21111-2--1--11--11121-11413322111111139DD2318BA9743344344345145A4493538227667643A966797411757565335544444444A1122222-----------------------------1221223A966-56262-222222823333213593563113335352466359B12-1-1121-------1111121631-132121112-----112--111111241--------------------1-11----212311--3------------1----1-1-11211------1223-211111111111-11111111111121111112232212121222222222222212111111111322222222222111-11111111112323---11--111----2--------1111222213132211211211111111111-----------1--22222222222222----111111--------111-----------1------1------2212231242122 1-------1---------------------------------------------------------------------------------------------------2-1-----------------------------------------------1-----1----------11118111112114-11--1---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTITTRDSLLTIRGLSASVDETPILHDIDLAVGPGETHVIMGPNGAGKSTLGHVVMGDAA:Sequence : ======================================================:RP:SCP|7->99|1q3hA|1e-16|19.8|91/265|c.37.1.12 : ======================================================:BL:SWS|7->214|ABCX_PORPU|6e-40|41.5|207/251 61: . . . * . .: 120 :YRMDGGSVEFDGRDITDLSPDKRSRAGLFLSFQAPVEIPGVPLSSFLRATVAGRDGKELK:Sequence :======================================= :RP:SCP|7->99|1q3hA|1e-16|19.8|91/265|c.37.1.12 :============================================================:BL:SWS|7->214|ABCX_PORPU|6e-40|41.5|207/251 121: . . + . . .: 180 :GKQFKKHVRTLADELDMDPSYLDRELGVGFSGGEKKKLEMLQLLLLEPKLAILDETDSGL:Sequence : XXXXXXXXXXXXXXXXXXXXXX :SEG|154->175|ekkklemlqllllepklailde : ############### :PROS|150->164|PS00211|ABC_TRANSPORTER_1|PDOC00185| :============================================================:BL:SWS|7->214|ABCX_PORPU|6e-40|41.5|207/251 181: . * . . . .: 240 :DVDALGVVSRGIDAYRRATGGALVVITHNTRILEHVDVDRVHVMVRGRMVAEGDSSLIES:Sequence : XXXXXXXXXXXXXXXX :SEG|215->230|hvdvdrvhvmvrgrmv :================================== :BL:SWS|7->214|ABCX_PORPU|6e-40|41.5|207/251 241: + . . . . *: 300 :INEQGFEQFEQAGAEAAREPVAAL :Sequence : XXXXXXXXXXXXXXXXXXXXX :SEG|243->263|eqgfeqfeqagaeaarepvaa