[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "elen0:ACV56234.1"

            "SUF system FeS assembly protein, NifU family"
            ""

OrgPattern ------------------------111111111------------1--------------------1- --11111111111111111-111111111111111111111111--1-1111111--1--11111111111111111111111-----------------------------------------------------11122---221--111-1111--------11-------------------11---111111111111111111122211111111111111111111111111111111111111111--11111-1111111111111111111111111111111111111111111111111111111111111---11------------11-------1111-------------221---12-1-------------------------------------------------------------------------11111111-11---1------------------------------1-----------------1111----111111-----1---------11--11-------1----------111---------------------------11111----------------------------------------1---------------------111-----------------------------------------------------------------------------------------------1111111111--------------------------------------------------------------------------------------------1111--------111--------------------------11111-11111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MASIYTAALMEHNAHPDYKYQMDEPTCTHDGVNPSCGDELTLSLRLRGDRIEEAAFTGHG:Sequence :cTHHHHHHHHHHHHcccccTTcccEEEEEEEEEEccEEEEEEEEEEETTEEEEEEEEccT:Sec Str : ==========================================================:BL:SWS|3->135|NIFU_BACSU|2e-20|33.1|130/147 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->123|PF01592|1e-16|35.0|120/126|NifU_N 61: . . . * . .: 120 :CAVSQAAADMMADLVTGETVGEARRLSGLYLDMIKGRPLTDEERADLDEAAELESIARMP:Sequence :TTccHHHHHHHHHHHTTccccccTTTHHHHHHHHHHcc ccccccccHHHHHHHHHTTcT:Sec Str : XXXXXXXXXXXXXXXX :SEG|99->114|ltdeeradldeaaele :============================================================:BL:SWS|3->135|NIFU_BACSU|2e-20|33.1|130/147 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->123|PF01592|1e-16|35.0|120/126|NifU_N 121: . . + . . .: 180 :ARVKCAELAWRTLEKLLDQQLEKA :Sequence :TTHHHHHHHHHHHHHHH :Sec Str :=============== :BL:SWS|3->135|NIFU_BACSU|2e-20|33.1|130/147 :$$$ :RP:PFM|4->123|PF01592|1e-16|35.0|120/126|NifU_N