[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACV56234.1 elen0 ACV56234.1 "SUF system FeS assembly protein, NifU family"
MASIYTAALMEHNAHPDYKYQMDEPTCTHDGVNPSCGDELTLSLRLRGDRIEEAAFTGHG
CAVSQAAADMMADLVTGETVGEARRLSGLYLDMIKGRPLTDEERADLDEAAELESIARMP
ARVKCAELAWRTLEKLLDQQLEKA
//