[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACV56461.1 elen0 ACV56461.1 "hypothetical protein"
MVAVIDNEELPKAFPSLEDLRSGHRALTPERKAELRELIRSTTLEAPDGWGERSFKELLE
RG
//