[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "elen0:ACV56675.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------3------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTDDPLTRYAALMNRANAPRELSRAVLDRIESQQSEQTRPTGATGSAAPRHQAGPAPTPF:Sequence 61: . . . * . .: 120 :SVKRHRFRGFAVAACLLLLAVLVGLSLAVPRFAKNAGPLGFAINAYGASGNSLLAMGEDG:Sequence : XXXXXXXXXXXXXXXXXXX :SEG|71->89|avaacllllavlvglslav 121: . . + . . .: 180 :RILFEADILFRVPPDDRYAEEGVYTGCMFRIEGDDIVRVQAHIDKGELYRYTYDEFQAAS:Sequence 181: . * . . . .: 240 :NPDRWAEAQQWSTASIGEGAFFGAYDLVQPVSSLSESEQPDNQTVGVKCYQRLGSTVDLP:Sequence : ===========:BL:SWS|230->311|SYR_SHESH|8e-04|29.3|82/100 241: + . . . . *: 300 :VNDEIGSRLSDYCFGLWTNEDAGAVTGYQDYIDTLDGATLTVTIEKADGSHATKSIELTA:Sequence :============================================================:BL:SWS|230->311|SYR_SHESH|8e-04|29.3|82/100 301: . . . . + .: 360 :ADVKAKLVPSETNGTPALELIPQIVDPFEGDVQERLNKRSEGYTWIHTLYGTVAEENCEP:Sequence :=========== :BL:SWS|230->311|SYR_SHESH|8e-04|29.3|82/100 361: . . . * . .: 420 :FPFEGEQLQSLDRPLTEPASQPAVEPASAEPDEAVTPQDTWVVCKNPLRLGEAIDVRFPV:Sequence 421: . . + . . .: 480 :NVIDDQQASGGSTEGLLTCTNGTVATQLPTEVRLENLALPNPGDLDDSNKFFKANGGFTL:Sequence 481: . * . . . .: 540 :DENGAPSDGYAYAAIDITVRNTSDKTLYADATQGWFGTVKKMGGEQFFAQSEPSWPLWTS:Sequence 541: + . . . . *: 600 :GIEHPIDSWNGNPFFVPIQPGETKTFTVLHVVAASDLADPTFSYHYRNTSYGGRTTATYR:Sequence 601: . . . . + .: 660 :IGALTLP :Sequence