[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACV56675.1 elen0 ACV56675.1 "hypothetical protein"
MTDDPLTRYAALMNRANAPRELSRAVLDRIESQQSEQTRPTGATGSAAPRHQAGPAPTPF
SVKRHRFRGFAVAACLLLLAVLVGLSLAVPRFAKNAGPLGFAINAYGASGNSLLAMGEDG
RILFEADILFRVPPDDRYAEEGVYTGCMFRIEGDDIVRVQAHIDKGELYRYTYDEFQAAS
NPDRWAEAQQWSTASIGEGAFFGAYDLVQPVSSLSESEQPDNQTVGVKCYQRLGSTVDLP
VNDEIGSRLSDYCFGLWTNEDAGAVTGYQDYIDTLDGATLTVTIEKADGSHATKSIELTA
ADVKAKLVPSETNGTPALELIPQIVDPFEGDVQERLNKRSEGYTWIHTLYGTVAEENCEP
FPFEGEQLQSLDRPLTEPASQPAVEPASAEPDEAVTPQDTWVVCKNPLRLGEAIDVRFPV
NVIDDQQASGGSTEGLLTCTNGTVATQLPTEVRLENLALPNPGDLDDSNKFFKANGGFTL
DENGAPSDGYAYAAIDITVRNTSDKTLYADATQGWFGTVKKMGGEQFFAQSEPSWPLWTS
GIEHPIDSWNGNPFFVPIQPGETKTFTVLHVVAASDLADPTFSYHYRNTSYGGRTTATYR
IGALTLP
//