[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "elen0:ACV56703.1"

            "drug resistance transporter, EmrB/QacA subfamily"
            ""

OrgPattern ------3211111111-------1--------1121--11---24211--111-------11111--- 324-B2145552-222122-23--7322222253346587-3453451132-2222-2--3351125765-32224541262-1211111-----------1---5-1-1--------------1111---111--222-311152-----------------------2-------------111-----52B9999999A399978772775699812234424344444J24333343333334353347258188152-29766AA43695A664222-1-1122-----------11111111111111--------1---67---1---1-112661111-----2--2-122221--2321-----11-711211112225332113211111331333333-1121142426--83339829883322-1-11-1111---1111111121111212------------11--111111111------242221122ACDADC6888699A9786738E7B6677--436-132231423124-----221111111---112-1111-1--1-----2-11113-111-11--1----------------------11-44332-21--11-11111-12222-1111-11-------------21531333323344333-33333343333333333322523522321-2223111222222533243421-333333333333----43232------21-111-11-11------33333-2223--2232675715452-343-1---11-1-2332222221-1--33322222221-----------------------------------------------------------11- -------------1----11-1--2--111-------------1111-2111-2--112-----1----1----1--------------1--------------2---------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRWWETEGRRHAGMKRVKSERMGVYALFAIVVLASASGNLSQTAVNAMLGDIMLQFGLTV:Sequence : ====================================:RP:SCP|25->183|1pw4A|1e-09|12.7|158/434|f.38.1.1 : =====================:BL:SWS|40->427|YHCA_BACSU|1e-54|35.9|387/532 61: . . . * . .: 120 :DLGQWLTTSYMLVLGITVPVATFLSRRFSVRQHVFIALAFFLVGALADLFAPNFGVLLAG:Sequence :============================================================:RP:SCP|25->183|1pw4A|1e-09|12.7|158/434|f.38.1.1 :============================================================:BL:SWS|40->427|YHCA_BACSU|1e-54|35.9|387/532 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|66->183|PF07690|5e-10|31.4|118/347|MFS_1 121: . . + . . .: 180 :RVFQAISTGMLMPLMQTIAMTRFPRGRQATAMGVAGIAMGFAPNIGPTIGGAMSFSLGWR:Sequence :============================================================:RP:SCP|25->183|1pw4A|1e-09|12.7|158/434|f.38.1.1 :============================================================:BL:SWS|40->427|YHCA_BACSU|1e-54|35.9|387/532 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|66->183|PF07690|5e-10|31.4|118/347|MFS_1 181: . * . . . .: 240 :SFFVLLVVIMLALAAAAAVAIKPSAAPDKSARLDVVSLAQSTLGFGGLLLAFSNASSFSF:Sequence : XXXXXXXXXXXXXXXXXX :SEG|184->201|vllvvimlalaaaaavai : XXXXXXXXX:SEG|232->244|fsnassfsfespf :=== :RP:SCP|25->183|1pw4A|1e-09|12.7|158/434|f.38.1.1 :============================================================:BL:SWS|40->427|YHCA_BACSU|1e-54|35.9|387/532 :$$$ :RP:PFM|66->183|PF07690|5e-10|31.4|118/347|MFS_1 241: + . . . . *: 300 :ESPFIWAPLVLGALFLVLFVRRQKRVDDPLISMDIFSSRQYRAGFIAQNLLNASFMGVTL:Sequence :XXXX :SEG|232->244|fsnassfsfespf : XXXXXXXXXXXX :SEG|249->260|lvlgalflvlfv :============================================================:BL:SWS|40->427|YHCA_BACSU|1e-54|35.9|387/532 301: . . . . + .: 360 :IVPLYVEGLCGGTALEAGVVLLPGTVAALVLNPLAGVLTDKVGVRPVALVSGAFLATGAV:Sequence :============================================================:BL:SWS|40->427|YHCA_BACSU|1e-54|35.9|387/532 361: . . . * . .: 420 :LMSFLDADTPLYVTTLCQAVRAVGVSGLVGPLTSWSLAQLPRPIVADGSSFCISARQACA:Sequence :============================================================:BL:SWS|40->427|YHCA_BACSU|1e-54|35.9|387/532 421: . . + . . .: 480 :SLGTSVMVFLIAVAGASAAGLANPALAYQLAFGFSAVMAVATLGFIVAKVR :Sequence : XXXXXXXXXXXXXXXX :SEG|432->447|avagasaaglanpala :======= :BL:SWS|40->427|YHCA_BACSU|1e-54|35.9|387/532